Details for Kale Locus Bo5g101160

Position : C5 ( 5`- 32465019 .. 32466026 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101160

Protein [Map View]
MEGLESVYAQAMYGMNRQNKIMEHQGSDLIWGGNELIPRELCSSSFSSHQLINPNLGSCFMSDLGVIDEIQHQQHVGNRA
ASIDPSSLECLLSATTNTSTEDDEGISALFSDCQTLWSFGGGISSAESENREITTDTTTKPKSLKRNRDETGSHFRLVHH
PQDDTEKGSFKLIYDENQTKSKKPRTEKGGGSSNISFGHSASLSDNAEPDAEAIAQMKEMIYRAAAFRPVNFGLETVEKP
KRKNVKISTDPQTVAARQRRERISEKIRVLQTLVPGGTKMDTASMLDEAANYLKFLRAQVKALENLRPKLDPTNLSFSSP
LFHPSFLPMQNPNQI*

DNA
ATGGAAGGATTAGAATCGGTTTATGCGCAAGCTATGTACGGTATGAACCGACAGAACAAAATCATGGAGCATCAAGGGTC
AGATTTGATCTGGGGAGGCAATGAGCTGATCCCTCGAGAGCTCTGTTCTTCTTCTTTCTCATCTCACCAGCTCATTAATC
CGAATCTTGGCAGCTGTTTCATGTCCGATCTTGGAGTCATTGATGAGATTCAACATCAACAACATGTCGGAAACAGAGCT
GCTTCCATAGATCCATCATCGCTGGAGTGTTTGTTATCAGCGACGACGAACACTTCGACGGAAGACGACGAAGGAATCTC
TGCGCTTTTCTCAGATTGTCAGACTCTTTGGAGCTTTGGTGGAGGAATCTCATCTGCAGAGTCTGAGAACAGAGAGATCA
CTACAGACACAACAACAAAGCCTAAGTCTTTGAAGAGAAACAGAGACGAGACAGGAAGTCACTTCCGTCTTGTCCATCAT
CCTCAAGATGATACAGAGAAGGGAAGCTTCAAGCTTATATACGATGAGAATCAAACAAAATCCAAGAAACCAAGAACAGA
GAAAGGAGGTGGTTCTTCCAACATCAGTTTCGGACATTCAGCTTCTTTGTCTGATAATGCCGAGCCTGATGCAGAAGCGA
TCGCGCAGATGAAGGAGATGATATACAGAGCCGCTGCGTTCAGACCGGTGAACTTCGGTTTGGAGACCGTTGAGAAGCCT
AAGAGGAAGAACGTGAAGATATCGACGGATCCTCAAACGGTGGCAGCGAGGCAGAGGAGGGAGAGGATAAGCGAGAAGAT
TAGGGTTTTACAGACATTGGTTCCAGGTGGGACTAAGATGGACACTGCTTCAATGCTTGATGAGGCTGCTAATTATCTTA
AGTTCCTTAGAGCGCAAGTAAAGGCTTTAGAAAACTTGAGACCCAAGCTTGACCCAACCAATCTCTCCTTCTCCTCTCCT
TTATTCCACCCTTCTTTTCTTCCCATGCAAAACCCTAATCAGATCTAA