Details for Kale Locus Bo5g101130

Position : C5 ( 5`- 32424525 .. 32425829 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101130

Protein [Map View]
MDASLVSADTFNGNAGEQIAPPLQPPGTDMTGICFRDQLWINSYPLDRNYVFDYFALSPFYDITCNNEILRRRSVHPLDH
SQLSKMTGLEYVISDATEPNFFVFRKQKRDGPEKVTPMLTYYILDGTIYQAPQLCTVFAARVGRAVFNISNAFSVAASKL
ETIRQVDAKSQNEPSESKPASETVDLKEVKRVDLILKSLYSKLPPAPPPPPFPEGYVSQEALGEKEEEVGTQGGESQQPQ
IDPIIDQGPAKRMKF*

DNA
ATGGACGCCTCTCTTGTCTCCGCCGATACCTTCAACGGCAATGCGGGGGAGCAGATTGCTCCTCCGCTGCAACCACCAGG
CACGGATATGACCGGTATATGTTTCAGGGATCAGCTCTGGATCAACTCGTACCCTCTAGACCGTAACTACGTCTTCGACT
ACTTCGCCTTGTCTCCCTTCTACGATATCACCTGCAACAACGAGATTCTTCGTCGTAGATCCGTTCACCCTCTCGATCAC
TCTCAGCTCTCGAAGATGACAGGATTAGAGTATGTGATCAGTGATGCTACTGAGCCAAACTTTTTCGTGTTTCGTAAGCA
GAAGAGAGATGGTCCTGAGAAAGTCACACCGATGCTGACGTATTATATCTTGGACGGTACTATATACCAAGCTCCTCAGC
TTTGTACTGTCTTTGCAGCTCGTGTTGGTCGGGCTGTTTTTAATATATCCAACGCTTTCTCGGTTGCTGCATCCAAGTTG
GAGACCATTAGGCAGGTTGATGCTAAAAGCCAGAACGAACCTTCTGAGTCAAAGCCTGCTAGTGAGACGGTTGATCTTAA
GGAAGTGAAGCGGGTCGATTTGATTCTTAAGTCTTTATATAGCAAGCTACCCCCAGCACCTCCACCACCACCCTTCCCTG
AAGGCTATGTTAGCCAGGAAGCATTAGGGGAAAAGGAAGAAGAGGTTGGAACACAGGGAGGAGAGTCACAACAGCCTCAA
ATTGATCCTATTATCGATCAAGGTCCTGCTAAAAGAATGAAGTTCTAA