Details for Kale Locus Bo5g101120

Position : C5 ( 5`- 32423743 .. 32424056 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101120

Protein [Map View]
METNPSKSSVLIYVLVLALVLSPILPCQAASVHLGGGGRKLMAPSPPLLMCPHCECCAPAAPGFCCPCSCPGGP*

DNA
ATGGAAACCAATCCATCGAAGTCCAGCGTCCTCATATATGTTCTAGTTCTTGCACTGGTCTTGTCTCCAATACTCCCATG
TCAAGCAGCTAGTGTGCATCTAGGAGGTGGAGGGCGTAAGTTGATGGCACCATCACCACCACTTCTCATGTGTCCACACT
GTGAGTGTTGCGCACCGGCTGCACCTGGCTTCTGCTGCCCATGTAGCTGTCCCGGTGGTCCCTAA