Details for Kale Locus Bo5g101080

Position : C5 ( 5`- 32404404 .. 32405631 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101080

Protein [Map View]
STHGHTQLLTRIVQQQTFARTEHEILVTSTKMAESLVETRVPQQKLYESKPFPAVISPSLPAPSLPLFTQTITTHKPYLD
SLLHRSGAVLFRGFPVSSASDFNDVVEAFGFDELPYVGGAAPRTSVVGRVFTANESPPDQKIPFHHEMAQVPEFPSKLFF
YCEVEPNSGGETPIVLSHVVYERMKEKHPEFVQRLEEHGLVYVRVLGEDDDPSSPIGRGWKSTFLTHDKSVAEERADKLG
MKLEWTEEGGAKTIMGPIPAIKFDKSRNRKVWFNSMVAAYTGWDDKRNDPRKAATFGDGEPLPEDIVHDCLRILEEECVA
VPWQRGDVLLIDNWAVLHSRRPFVPPRRVLASLCK*

DNA
AGTACACATGGACATACTCAGTTACTGACACGAATTGTCCAGCAACAGACTTTTGCAAGAACAGAGCATGAAATTTTAGT
AACATCGACAAAAATGGCCGAATCATTGGTGGAAACTCGAGTCCCACAACAAAAGCTCTACGAATCGAAACCTTTCCCGG
CGGTTATATCACCGTCACTCCCTGCTCCGTCTCTCCCACTCTTCACACAAACCATCACCACCCACAAACCCTATCTCGAC
TCCCTCCTCCACCGATCCGGAGCCGTCCTCTTCAGAGGCTTCCCCGTCTCTTCCGCCTCAGACTTCAACGACGTCGTTGA
AGCTTTCGGTTTCGACGAGCTTCCTTACGTCGGAGGCGCCGCGCCGCGCACTAGCGTAGTCGGTCGTGTCTTCACCGCTA
ACGAGTCTCCTCCTGATCAAAAGATCCCATTTCACCACGAGATGGCTCAGGTTCCTGAGTTTCCATCAAAGTTGTTCTTT
TACTGCGAGGTGGAGCCTAACTCTGGAGGAGAGACACCGATCGTGTTGAGTCACGTTGTGTACGAGAGAATGAAAGAGAA
GCATCCAGAGTTCGTTCAGAGGTTGGAGGAACATGGTTTGGTCTACGTCAGGGTTTTAGGTGAAGATGATGATCCTTCTT
CACCCATCGGCCGTGGCTGGAAATCAACATTCTTGACTCACGACAAGAGCGTTGCTGAGGAAAGGGCAGATAAACTGGGA
ATGAAACTGGAGTGGACCGAGGAAGGAGGAGCCAAGACAATAATGGGTCCAATCCCGGCTATCAAGTTCGACAAGTCGAG
AAACCGTAAAGTATGGTTCAACAGCATGGTGGCTGCTTACACAGGGTGGGATGATAAGAGGAATGATCCAAGAAAGGCTG
CGACTTTTGGAGATGGGGAGCCTTTACCTGAAGATATAGTCCATGACTGTCTTAGGATACTTGAGGAAGAATGTGTTGCT
GTTCCGTGGCAGAGAGGAGATGTTCTGCTTATAGACAACTGGGCTGTTCTTCACTCACGAAGACCGTTTGTTCCTCCTCG
CAGAGTGCTTGCATCGCTTTGCAAATAG