Details for Kale Locus Bo5g101070

Position : C5 ( 5`- 32402953 .. 32404215 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101070

Protein [Map View]
MGQQLRRAVGRVKEVEKFPSRFDRRSLPKEELSAGKSPSINDVSARGGSSEDSERDPQYDTMLNQMVGRIKAKPGGKAEM
GEASVVETSKRPLPKLRNTTPESTRYEEKPVSQGTLNVAQVRHIMLLYQGKAQDHNGPMTLNEIAKNYRIDVSQVQKITQ
FLSLPPETTDKQKKRYE*

DNA
ATGGGTCAGCAACTGCGTCGAGCCGTTGGGAGAGTCAAAGAAGTTGAAAAGTTTCCATCAAGGTTCGATCGGAGATCTCT
TCCAAAAGAAGAACTCAGCGCCGGGAAATCTCCGTCTATTAATGATGTTTCTGCTCGAGGAGGCAGCAGTGAGGATAGTG
AAAGAGACCCACAATACGATACAATGTTGAACCAAATGGTTGGGAGAATAAAGGCTAAACCTGGTGGCAAAGCCGAGATG
GGAGAGGCATCGGTAGTGGAAACGTCGAAAAGACCACTCCCAAAGCTCCGGAACACTACTCCTGAATCAACAAGGTACGA
GGAAAAACCGGTGTCGCAAGGAACACTGAACGTGGCTCAAGTGAGACACATCATGCTCCTCTATCAGGGCAAGGCTCAGG
ATCACAACGGTCCGATGACTCTGAACGAAATTGCCAAAAACTACAGGATTGACGTCTCCCAGGTCCAGAAAATCACCCAG
TTCCTGTCTTTGCCACCAGAGACTACTGATAAGCAGAAGAAACGATATGAATAA