Details for Kale Locus Bo5g101040

Position : C5 ( 5`- 32375622 .. 32383183 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101040

Protein [Map View]
MAPSRSTKSKYKRTPRPKDVSPHKEEESMSKTKPRKRKLSDMLGPQWSKEELERFYEGYRKFGKEWKKVAGFVHSRSAEM
VEALYTMNKAYLSLPEGTASVVGLTAMMTDHYAVLHGGSDSEQEKNETLRSASKRSKLKSSDHPSAGLEGLSDRLQFRSS
SGYLPSLKKRRTETMPRAVGKRTPRIPVSYTPEKDTRERHMSPVKKSLNQKGDDTDDDMEHEIALALTEASQRGGSTKNP
HTPNRKSKMFSPDKKSEIMRADIDMAIAKLRATDTEDAQCEPSLESTEAENVDNPGNRNELTNGEDRSAMKEKQYYRRRF
GIKEDDSKEACSGTDEAQSLGTLDEKFKQEGDGKFLKFTYRSSRRKSKKSLFTADEDTACDALQTLADLSLMMPETATDT
ESSVQAEEKRAGKASDYKETDLASMSKRGSLRKWKQKRPVCNDLCNTEPERKSPSSSVIRKGRQKASPAKVPKDELAAIS
QVTEPSKNKGIGEEIKPVGRGKRSASIRNSYEKKCVKPQDRTSSSNNMVDDDESAPSTAATQKEVNLPTKVRSRRKIVTE
KPLTIDDVKKSEILEKFSHCISSFKARRWCLFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTRVEWGVIRSSLGKPR
RFSQQFLKEEKEKLYLYRDSVRKHYDELNTGMREGLPMDLARPLNVSQRVICLHPKSREIHDGSVLTVDHCRYRIQFDNP
ELGVEFVKDTECMPLNPLENMPASLAKHYVLSNHHRQNSSEEKMHERVKESMPEGYPKLSCEAGCPLSPPNYIINNSLKQ
EKVEISSSDPQAQNGVDEALAVQLFNSQPSNIGHIHAREADVQALSELTRALDKKELVLRELNYMNNEVVESEKDGHNAL
KDSESFKKQYAAVLFQLSEINEQVSLALLGLRQRNTYQENVPSSSITHMSNSGEPDRQLTYVDNDASDTNGFHVSEIVDS
SRVKARKMVFRAIQALALLRKDENNVVNIEEAIDFVNNQLSTDESEGSSVQQTQASQDQRLPSTPNPSSSTQHADDSHVN
PLDQNDLQVPSELVSRCMATLLMIQRCTERQFPPSEVAQVLDSAVASLQPCCSQNLPIYTEIQKCMGIIRNQILALVPS*

DNA
ATGGCGCCTTCAAGATCAACGAAATCTAAGTACAAGAGAACTCCGCGTCCTAAGGATGTTTCTCCTCACAAAGAAGAAGA
AAGTATGAGCAAAACCAAACCACGGAAGAGGAAGTTGTCGGATATGTTAGGTCCTCAGTGGAGCAAGGAAGAGTTGGAGC
GCTTTTATGAAGGATACCGCAAATTTGGAAAAGAATGGAAAAAGGTCGCTGGTTTTGTACATAGTCGTTCTGCAGAGATG
GTAGAGGCTCTATACACTATGAATAAGGCTTACTTGTCTCTTCCGGAAGGCACTGCTTCTGTCGTTGGCCTTACTGCAAT
GATGACTGATCACTACGCTGTTCTGCATGGAGGAAGTGACAGTGAGCAGGAGAAAAACGAAACTCTGAGGTCAGCTTCTA
AGCGCTCTAAATTGAAATCCTCAGATCATCCCTCCGCAGGATTAGAGGGTCTGTCTGACCGCCTGCAGTTCAGGTCCTCT
TCAGGCTACTTGCCATCACTGAAGAAGAGACGTACTGAGACAATGCCTCGTGCTGTTGGAAAAAGGACACCTAGAATTCC
TGTCTCATATACCCCTGAGAAGGATACTAGGGAAAGACATATGTCACCTGTTAAGAAGTCTCTAAATCAGAAGGGGGATG
ATACTGATGATGATATGGAACATGAGATTGCATTAGCATTGACTGAGGCTTCACAACGAGGTGGTTCTACCAAAAACCCA
CACACACCAAATAGAAAATCAAAGATGTTCTCCCCTGATAAGAAGAGTGAAATAATGCGTGCTGATATTGACATGGCGAT
TGCCAAGCTCCGTGCCACTGATACGGAAGATGCCCAATGTGAACCAAGCTTAGAAAGTACTGAAGCTGAAAATGTGGATA
ACCCAGGAAATAGAAATGAGTTGACGAATGGAGAAGATAGAAGTGCCATGAAAGAAAAACAGTACTATAGAAGGAGGTTC
GGCATCAAAGAAGATGATTCAAAAGAGGCCTGCAGTGGTACAGACGAAGCACAAAGCTTAGGCACTCTCGATGAGAAATT
TAAACAAGAAGGGGATGGGAAGTTTTTGAAATTCACATATAGAAGTTCAAGGAGAAAAAGTAAAAAAAGTCTTTTTACTG
CAGATGAAGACACAGCATGTGATGCTCTCCAGACGCTGGCAGATCTATCGCTGATGATGCCTGAAACTGCCACGGACACT
GAGTCATCTGTTCAAGCTGAGGAAAAGAGAGCTGGGAAGGCTTCAGATTATAAAGAGACTGATCTAGCGTCCATGTCTAA
AAGGGGCTCTCTTAGAAAATGGAAACAGAAAAGACCCGTCTGCAATGATCTTTGTAATACTGAGCCCGAGAGAAAGAGTC
CAAGTAGCTCTGTAATCAGAAAGGGACGGCAGAAAGCATCACCAGCTAAAGTTCCTAAAGATGAGCTTGCTGCAATTTCA
CAAGTCACTGAGCCTTCTAAAAACAAGGGAATAGGTGAGGAAATTAAGCCTGTTGGGAGAGGTAAACGGTCTGCAAGTAT
TCGAAACTCGTATGAAAAGAAGTGTGTCAAACCCCAGGATCGTACTTCTTCAAGTAACAACATGGTAGATGACGATGAGT
CAGCTCCATCAACTGCAGCCACGCAAAAAGAAGTTAACTTGCCAACTAAAGTTAGAAGCAGAAGAAAGATAGTAACTGAG
AAACCTCTAACTATTGATGACGTGAAGAAGTCAGAGATTTTGGAGAAGTTTTCGCATTGCATATCTAGTTTCAAAGCACG
AAGATGGTGTCTTTTTGAGTGGTTCTATAGCGCAATTGACTACCCATGGTTTGCCAGACAAGAGTTTGTTGAGTACTTGG
ATCATGTAGGGTTGGGCCATGTTCCTAGGTTAACTCGCGTTGAATGGGGTGTCATAAGGAGTTCTCTTGGGAAACCAAGG
CGTTTTTCTCAACAGTTTCTGAAGGAGGAAAAAGAAAAGCTATACCTATACAGGGATTCTGTAAGAAAACATTACGATGA
ACTAAACACGGGTATGAGGGAAGGACTTCCGATGGATCTGGCTCGGCCTCTAAATGTTTCACAGAGAGTTATTTGCCTTC
ATCCAAAGTCAAGAGAGATTCATGACGGCAGTGTCCTAACCGTTGATCACTGTAGGTACCGGATTCAGTTTGACAACCCT
GAACTAGGGGTGGAATTTGTCAAGGATACTGAATGCATGCCACTAAATCCTCTAGAAAACATGCCAGCATCACTTGCAAA
ACACTATGTTTTGTCGAATCATCACCGTCAGAATTCCAGCGAGGAGAAAATGCATGAGCGGGTAAAGGAAAGCATGCCTG
AAGGGTACCCCAAACTTTCGTGCGAGGCAGGCTGTCCCCTATCCCCACCAAATTATATCATTAACAATTCACTAAAGCAG
GAAAAGGTAGAAATCTCAAGTTCGGATCCACAAGCTCAAAATGGAGTCGATGAGGCTCTTGCTGTACAATTGTTTAATTC
TCAGCCCTCAAATATTGGCCATATTCATGCGAGAGAAGCTGATGTCCAAGCTCTTTCTGAACTAACACGTGCGCTTGACA
AGAAGGAGCTAGTTTTGAGGGAGCTAAATTACATGAACAACGAGGTTGTGGAAAGTGAGAAAGACGGACACAACGCTCTG
AAGGATTCTGAATCTTTTAAGAAACAATATGCTGCAGTTCTCTTTCAGCTAAGCGAAATAAATGAACAGGTTTCATTGGC
ACTTCTTGGCCTGAGGCAACGGAATACTTACCAGGAGAATGTACCATCTTCTTCAATAACACACATGAGCAACTCAGGGG
AACCTGATAGACAGTTGACGTACGTAGACAATGATGCATCTGATACTAATGGATTCCATGTCTCTGAGATTGTTGACAGT
TCTAGAGTAAAAGCTCGGAAAATGGTATTCAGAGCTATACAGGCATTGGCGTTATTAAGGAAAGACGAAAATAATGTTGT
AAATATAGAAGAAGCCATTGATTTTGTTAATAACCAGCTCTCGACAGATGAATCAGAAGGATCATCAGTCCAGCAAACAC
AAGCTTCCCAGGATCAGCGTCTTCCCTCTACACCAAATCCTTCTAGCTCTACTCAACATGCAGATGATTCCCACGTAAAC
CCACTAGACCAAAATGACCTGCAGGTTCCGTCTGAACTTGTTTCACGCTGTATGGCTACATTGCTCATGATTCAGAGATG
TACAGAGAGGCAATTCCCACCAAGTGAAGTGGCTCAGGTTCTAGATTCGGCTGTAGCCAGCTTACAGCCTTGCTGCTCAC
AGAACCTTCCTATTTATACAGAGATACAAAAGTGCATGGGAATCATTAGAAACCAGATTCTAGCCCTCGTACCCTCCTAG