Details for Kale Locus Bo5g101030

Position : C5 ( 5`- 32367397 .. 32369583 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g101030

Protein [Map View]
MQYLSNSRRIARALKPLALLEADVRFASHVVDSTQWQNHRSTSVPVSPGMNTQSHMTGLMMLRSSFSSEAKLVEDPTEAV
KELHGKILDSVNVKRSMPPNALLWSLIENCRKEDDISFLFDALQNLRRFRLSNLRIHDNFNCNLCRQVAKTCVRVGAINH
GKRALWKHNVHGLTPSVASAHHLLSYALEHKNSNLMDEVMKLLKANDLPLQPGTADLVFRICHETDSWDLLAKYSKKFCK
AGVKLRKTTFDVWMEFAAKRGDTESLWKVDKLRSETYTQHTLSAAFSCAKGFLLEHKPEEAAAVIQIICQAYPDEKKSAL
EAEFKKLVNEWPVDVLKHQNEEDKKAVAASLKSDIPAMVNALVNSGLRVSVDLDELNKNEALLS*

DNA
ATGCAGTATCTATCGAACTCTCGTAGAATCGCTCGGGCTCTGAAACCGCTTGCACTCCTCGAGGCTGATGTGAGATTCGC
TTCTCATGTTGTTGACTCTACCCAATGGCAGAACCATCGATCTACTTCGGTTCCTGTCTCTCCAGGGATGAACACTCAGT
CACACATGACGGGGCTTATGATGCTGAGATCAAGCTTTTCCTCTGAAGCAAAACTTGTCGAAGATCCTACAGAGGCTGTC
AAGGAGCTACATGGTAAGATACTTGATTCTGTGAATGTCAAGAGATCCATGCCTCCAAATGCTTTGTTGTGGTCGTTGAT
TGAGAATTGTCGCAAGGAGGATGACATTAGTTTCCTCTTTGATGCTCTCCAGAATCTCCGGAGATTTAGGTTGTCCAATC
TCCGTATACATGACAACTTTAATTGCAATCTATGCCGGCAAGTTGCTAAGACCTGTGTACGTGTGGGAGCAATTAACCAT
GGTAAACGGGCTCTTTGGAAACATAATGTTCATGGTTTGACTCCTAGCGTTGCATCTGCTCACCATTTACTGTCTTATGC
GTTAGAGCACAAGAACTCTAACCTCATGGACGAAGTGATGAAACTCTTGAAGGCGAATGACCTGCCGTTACAACCCGGCA
CAGCAGATTTAGTTTTCAGGATCTGTCATGAGACAGATAGCTGGGATCTATTAGCTAAGTATTCTAAGAAGTTCTGCAAA
GCTGGAGTCAAGTTAAGGAAGACCACTTTTGATGTATGGATGGAATTTGCTGCCAAAAGAGGAGACACGGAGTCTTTATG
GAAGGTTGATAAGCTGAGATCTGAGACTTACACCCAACATACTCTTTCCGCAGCCTTTTCATGTGCAAAGGGTTTTCTGC
TAGAACATAAACCAGAAGAAGCTGCTGCTGTCATCCAAATTATCTGCCAGGCATATCCTGATGAGAAGAAGTCAGCACTT
GAGGCTGAATTCAAGAAGCTGGTAAACGAGTGGCCAGTGGATGTTCTCAAGCACCAAAACGAAGAAGATAAGAAGGCTGT
AGCAGCTTCATTGAAATCTGACATCCCTGCAATGGTCAATGCTTTGGTGAATTCGGGTTTAAGAGTGAGTGTGGATTTGG
ACGAGTTAAACAAGAATGAAGCTCTTCTCAGCTGA