Details for Kale Locus Bo5g100960

Position : C5 ( 5`- 32286346 .. 32286903 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g100960

Protein [Map View]
MSTTFKAIRDRTYSGVGDLIRLLPTGTVFLFQFLNPVLTNNGHCLLINKYLTGALIVICAFSCCFTCFTDSYRTSDGYVH
YGVATVKGIWPDSSSKDLSSYRLRVGDFVHAFFSLIVFSVISLLDSNTVNCFYPGFGSTGKIFLMVLPPVIGVISGTVFT
VFPTRRHGIGNPSENNDENASEMEK*

DNA
ATGTCGACAACATTCAAAGCCATAAGAGACCGGACATACTCAGGCGTAGGAGACCTCATCAGACTCCTCCCGACAGGAAC
CGTCTTCTTGTTTCAGTTCTTAAACCCTGTCTTAACCAACAATGGACATTGCCTCCTTATCAACAAATACTTAACCGGAG
CTCTTATCGTTATATGCGCCTTCTCGTGCTGCTTCACTTGCTTCACCGATAGCTACCGAACTAGTGACGGTTACGTTCAC
TATGGAGTCGCTACCGTGAAGGGTATCTGGCCAGATTCTTCTTCAAAGGATTTGTCTTCGTATCGGCTTAGAGTTGGAGA
TTTCGTTCACGCTTTCTTCTCTCTTATCGTTTTCAGTGTTATTTCTTTGTTGGATTCTAATACTGTTAACTGTTTCTATC
CTGGATTTGGTTCCACTGGGAAGATTTTTCTAATGGTTTTGCCTCCAGTGATAGGAGTTATATCCGGCACTGTCTTCACG
GTGTTCCCTACTAGACGTCACGGAATTGGGAATCCGTCCGAGAACAATGACGAAAATGCTTCTGAGATGGAGAAATGA