Details for Kale Locus Bo5g100950

Position : C5 ( 5`- 32265540 .. 32267033 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g100950

Protein [Map View]
MELSSSPLPPHVMLVSFPGQGHVNPLLRLGKLLASKGLLVTFVTTESWGKKMRTANKIQDRALKPIGKGYLRFDFFNDGL
PEDDDASRTNLTILRPQLELVGQQEIKNLVKRYKEVMKQPVTCLINNPFVSWVCDVAEDLQIPCAVLWVQSCACLASYYY
YNHKLVDFPTETDPRIDVQIPCMPVLKHDEIPSFIHPFSPYSGLREVIIDQIKRLHKPFAVLIDTFYSLEKDIIDHMTNL
SRTGVVRPLGPLYKMAKTLICDDIKGDMSETRDDCMEWLDSQPVSSVVYISFGTVAYVTQEQISEIALGVLNADVSFLWV
IRQQELGVNKERHVLPEELKGKGKVIEWCSQEKVLAHPSVVCFVTHCGWNSTMEALSSGVPTVCFPQWGDQVTDAAYMID
VFKTGVRLSRGETEERVVSREEVAERLREVTKGEKATELKKNALKWKEEAEAAVARGGSSDRNLDQFVEKLGVKPVAKQN
GSLNQNGSIQKLLLQKS*

DNA
ATGGAACTATCATCTTCTCCTTTACCTCCTCATGTTATGCTTGTATCCTTCCCAGGACAAGGCCACGTTAATCCACTTCT
TCGTCTCGGCAAGCTCTTAGCTTCGAAGGGTTTACTCGTCACTTTTGTCACCACAGAATCATGGGGCAAAAAGATGCGAA
CCGCCAACAAGATTCAAGACCGAGCCCTCAAACCTATCGGTAAAGGTTATCTCCGGTTCGATTTCTTCAACGATGGGCTC
CCTGAAGACGACGATGCAAGCAGAACCAACTTAACCATCCTCCGACCACAACTCGAGCTGGTCGGACAACAAGAGATCAA
AAACCTCGTGAAACGTTACAAGGAAGTGATGAAACAGCCCGTGACGTGTCTCATCAACAACCCTTTCGTCTCTTGGGTCT
GTGACGTAGCCGAAGATCTTCAAATCCCCTGTGCTGTTCTCTGGGTCCAGTCTTGTGCTTGCCTAGCTTCTTATTATTAT
TACAACCACAAGCTTGTCGACTTCCCGACCGAAACAGATCCCAGGATCGATGTCCAGATCCCGTGCATGCCTGTCTTGAA
ACACGACGAGATCCCTTCTTTCATCCATCCTTTTTCACCTTATTCGGGTTTAAGAGAAGTGATCATTGATCAGATCAAAC
GTCTTCACAAGCCTTTCGCTGTTCTCATCGATACTTTCTACTCCTTGGAGAAAGATATCATCGACCACATGACAAACCTC
TCTCGCACCGGCGTTGTCAGACCGCTCGGACCGCTTTACAAAATGGCCAAAACGTTGATTTGTGATGACATCAAAGGAGA
TATGTCTGAGACGAGGGATGACTGCATGGAGTGGTTAGACTCGCAGCCTGTTTCGTCCGTTGTTTACATCTCATTTGGTA
CCGTGGCTTACGTGACACAAGAACAGATCAGCGAGATTGCGTTAGGCGTTTTAAACGCTGACGTTTCGTTCTTGTGGGTG
ATAAGACAACAAGAATTAGGTGTAAACAAAGAGCGACATGTTCTGCCTGAAGAACTCAAAGGGAAAGGTAAAGTCATTGA
ATGGTGTTCACAAGAGAAAGTCTTAGCTCATCCTTCTGTGGTTTGTTTCGTGACTCATTGTGGATGGAACTCAACGATGG
AAGCTTTGTCTAGTGGAGTCCCAACGGTCTGTTTTCCTCAGTGGGGAGATCAAGTCACCGACGCTGCTTACATGATCGAC
GTGTTCAAGACGGGAGTGAGGCTTAGCCGTGGAGAGACGGAGGAGAGGGTGGTGTCTAGGGAGGAAGTAGCGGAGAGGCT
GAGAGAAGTTACGAAAGGAGAGAAAGCGACGGAGCTGAAGAAGAATGCTTTAAAATGGAAGGAGGAGGCGGAAGCGGCCG
TGGCTCGCGGTGGCTCGTCGGATCGGAATCTTGATCAGTTTGTGGAAAAGTTGGGCGTGAAACCTGTGGCTAAACAGAAC
GGAAGTCTCAATCAAAACGGAAGTATTCAAAAACTTTTATTGCAAAAGTCATAA