Details for Kale Locus Bo5g099950

Position : C5 ( 5`- 32244026 .. 32246117 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g099950

Protein [Map View]
MGCFGPSKSSRTRNQERDTTRRSPPPQPPHQTVRAEEILLHIPRCRVHLIDESEAVELASGDFNLVKVSDNGVTLAMIVR
IGHGLQWPVIKDEPVVKLDARDYLFTLPVKDGDPLSYGVTFSSDDRDVAVANSLKLLDEFLKENSCFSYSASSKVDNGID
WKEFAPRIEDYNNVVAKAIAGGTGHIIRGLFSCSNAYTNQVHKGGEVMITKADQEKSGASQRNGCCNSGNSSSTEKKNGI
NTNLQRARKLSKATEQLSKTMLNGAGVVSGSVMVPVMKSKPGKAFFSMVPGEVLLASLDALNKILDAAEAAERRALTATS
RAATRMVSERFGENAGEATGDVLATAGHAAGTAWNVFQIRKTFYPSSSLKSGIVRNAPRK*

DNA
ATGGGATGTTTCGGACCATCAAAATCTTCAAGAACAAGAAACCAAGAACGAGACACCACTCGACGAAGCCCACCTCCTCA
ACCTCCACATCAAACCGTGAGAGCTGAAGAGATTCTATTACATATTCCAAGATGTAGAGTCCATCTCATCGACGAATCCG
AGGCCGTGGAGCTCGCCTCCGGTGATTTCAATCTCGTCAAAGTCTCAGACAACGGCGTGACTCTCGCCATGATCGTCAGG
ATCGGACATGGCCTCCAGTGGCCGGTGATTAAAGACGAGCCGGTGGTGAAACTCGACGCACGTGATTACCTCTTCACGCT
TCCGGTTAAAGACGGTGATCCACTTAGCTATGGGGTCACTTTCTCAAGCGACGATAGAGATGTAGCCGTTGCAAACAGCT
TGAAGTTGCTTGACGAGTTCTTGAAGGAGAACTCTTGTTTCTCGTATTCGGCTTCGAGTAAAGTTGACAATGGAATCGAC
TGGAAAGAGTTCGCGCCGAGGATTGAAGATTATAACAACGTTGTTGCTAAGGCTATTGCTGGAGGAACAGGACATATCAT
TAGAGGACTCTTCAGTTGCAGCAACGCTTACACCAACCAGGTTCACAAGGGAGGTGAAGTAATGATTACAAAGGCTGATC
AGGAGAAGAGTGGTGCCTCTCAGAGAAATGGATGCTGCAACAGTGGAAACTCCAGTAGTACTGAGAAGAAAAATGGAATC
AACACAAACCTTCAACGAGCGAGGAAGCTTTCAAAGGCGACAGAGCAGCTGAGCAAGACGATGTTGAATGGTGCTGGAGT
TGTGAGCGGCTCTGTAATGGTTCCTGTGATGAAGTCGAAACCAGGGAAGGCTTTCTTCTCCATGGTTCCAGGGGAGGTTC
TCTTGGCTTCACTTGATGCCCTTAATAAAATACTAGACGCAGCTGAAGCCGCAGAGAGACGAGCTCTAACTGCTACTTCC
AGGGCTGCTACCAGAATGGTCAGCGAGAGGTTTGGAGAGAACGCAGGGGAGGCGACGGGAGACGTACTAGCAACTGCGGG
CCACGCGGCTGGAACAGCATGGAATGTTTTTCAGATCCGCAAGACTTTCTATCCGTCATCTTCTCTCAAGTCAGGGATCG
TAAGAAATGCTCCAAGAAAGTGA