Details for Kale Locus Bo5g099940

Position : C5 ( 5`- 32239210 .. 32240471 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g099940

Protein [Map View]
MDEVMTVADAGGSRASNLNGSPSSQNLLPHNLPLLSAFLAFALAQFLKVFTNWYKEKRWDSKKMISSGGMPSSHSATVTA
LALAIGLAEGAGSPAFAIALVLACVVMYDASGVRLHAGRQAELLNQIVCEFPSEHPLSTVKPLRELLGHTPIQVAAGAVL
GCVVAYLMRSTS*

DNA
ATGGACGAGGTGATGACAGTGGCGGACGCGGGGGGAAGCAGGGCGTCGAACTTGAACGGATCTCCTTCGTCGCAGAATCT
CCTTCCCCACAATCTTCCCCTCTTATCCGCTTTTCTTGCATTCGCTCTCGCCCAGTTCCTCAAAGTCTTCACTAATTGGT
ACAAAGAAAAGAGATGGGACTCTAAAAAGATGATTAGTTCTGGTGGAATGCCTTCCTCTCACTCTGCTACTGTCACTGCC
TTAGCTCTTGCCATTGGCCTTGCAGAAGGTGCTGGATCACCCGCTTTTGCTATCGCTCTTGTCTTGGCCTGCGTTGTAAT
GTATGATGCCTCTGGGGTCAGGCTTCATGCTGGTCGTCAAGCTGAGCTACTGAATCAAATTGTTTGTGAGTTTCCGTCCG
AGCATCCGTTATCCACAGTTAAACCCTTGCGTGAACTGCTCGGCCACACTCCTATCCAGGTTGCAGCCGGTGCTGTTTTA
GGATGCGTGGTAGCTTATTTGATGAGGAGCACAAGCTAG