Details for Kale Locus Bo5g099880

Position : C5 ( 5`- 32207321 .. 32209362 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g099880

Protein [Map View]
MVHVSSHRAKDGSEEAFDYRGNPPDKSKTGGWLGAGLILGSELSERICVMGISMNLVTYLVGDLHISSAKSATIVTNFMG
TLNLLGLLGGFLADAKLGRYKMVAISASVTALVKPLTTSLYPREISSSDSFVHVKSQGVLLLTVATTIPSMRPPLCDDFR
RLHHQCVEANGHQLALLYVALYTIALGGGGIKSNVSGFGSDQFDTSDPKEEKQMIFFFNRFYFSISLGSLFAVIVLVYIQ
DNVGRGWGYGISAATMVVAAVVLLCGTKLYRFKKPKGSPFTVIWRVCFLAWKKRNQSYPSHQSLLNGYDNTTVPHTERLK
CLDKAAVVVEESSPSTKEFKEKDPWMVSTVTQVEEVKLVVKLIPIWATNILFWTIYSQMTTFTVEQATFMERKLGSFTVP
AGSYSAFLILTILLFTSLNERVFVPLARMVTKKPQGITSLQRIGVGLVLSMAAMAVAAVIENARREAEVTNGYKISAFWL
IPQYFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLSTISMGFFVSSLLVSLVDKVTHKSWLRSNLNKARLNYFYWL
LFVLGAFNFLVFIVFAMKHQYKADMISVGVDDSVEKEKEKSELELKDIP*

DNA
ATGGTTCATGTGTCGTCGCATAGAGCTAAAGATGGCTCGGAAGAAGCCTTTGACTATAGAGGAAATCCACCTGATAAGTC
CAAAACCGGTGGATGGTTAGGCGCCGGTTTAATCTTAGGGAGTGAACTCTCGGAGAGAATATGCGTGATGGGCATATCAA
TGAACCTGGTGACGTACCTTGTCGGAGATTTACACATCTCATCAGCAAAATCTGCAACCATAGTCACAAACTTCATGGGA
ACACTCAACCTCTTAGGACTTCTTGGTGGTTTCTTGGCTGATGCTAAACTCGGTCGGTACAAGATGGTCGCAATCTCAGC
CTCTGTCACAGCTCTGGTAAAACCCTTAACCACGTCTTTGTACCCTCGAGAGATTTCTTCCTCTGATTCTTTTGTTCATG
TGAAATCACAGGGAGTGTTGCTGTTGACAGTGGCAACAACCATCCCAAGCATGAGACCACCACTCTGTGATGACTTCAGG
AGACTTCACCATCAGTGCGTAGAAGCAAACGGTCACCAGCTAGCTCTTCTCTACGTCGCTCTCTACACCATAGCTCTAGG
CGGAGGAGGGATCAAGTCCAACGTGTCCGGTTTCGGGTCTGACCAGTTCGACACGAGTGATCCCAAAGAAGAGAAGCAGA
TGATTTTCTTCTTCAACAGATTCTACTTCTCCATCAGCCTTGGGTCTCTCTTCGCCGTGATTGTCCTGGTTTACATCCAG
GACAACGTCGGGAGAGGCTGGGGCTACGGAATCTCGGCCGCGACCATGGTGGTTGCGGCCGTGGTTCTGCTCTGCGGGAC
GAAACTGTACCGTTTCAAGAAACCTAAAGGAAGCCCTTTTACCGTTATATGGAGGGTTTGTTTCTTGGCCTGGAAGAAAA
GAAACCAAAGCTACCCTTCGCATCAGAGTCTTTTAAACGGTTATGACAACACAACGGTTCCCCACACGGAGAGGCTAAAG
TGTTTAGACAAAGCTGCGGTTGTAGTAGAAGAGAGCTCTCCTAGTACCAAGGAGTTCAAAGAGAAGGATCCGTGGATGGT
TTCGACCGTTACACAGGTCGAAGAAGTGAAGCTAGTTGTGAAATTGATTCCCATTTGGGCAACGAACATTCTCTTCTGGA
CGATTTACTCCCAAATGACGACTTTCACGGTGGAACAAGCCACATTTATGGAGCGTAAACTCGGGTCTTTCACGGTTCCC
GCAGGGTCCTACTCTGCGTTTCTCATCCTCACCATCCTCCTCTTCACTTCCCTTAACGAGAGAGTCTTTGTGCCTTTAGC
AAGAATGGTTACAAAGAAGCCTCAAGGAATCACCAGCCTTCAGAGAATAGGAGTAGGGCTTGTGTTGTCAATGGCTGCAA
TGGCGGTAGCAGCGGTTATAGAGAACGCTAGACGCGAGGCAGAGGTTACCAACGGTTATAAGATAAGCGCGTTCTGGTTG
ATTCCACAGTACTTCTTGGTTGGTGCTGGTGAAGCTTTTGCTTACGTTGGGCAGCTTGAGTTCTTTATAAGAGAAGCACC
AGAGAGGATGAAGTCGATGAGCACCGGGTTGTTTTTGAGCACGATTTCGATGGGATTCTTTGTGAGCAGCTTGCTTGTTT
CTCTTGTTGATAAGGTAACGCACAAGAGCTGGCTTAGAAGCAACCTTAACAAAGCGAGACTGAACTACTTCTACTGGTTG
CTTTTTGTCTTGGGAGCTTTCAATTTCTTGGTTTTTATAGTGTTTGCGATGAAGCATCAGTACAAAGCTGATATGATTAG
TGTTGGGGTTGATGATTCAGTGGAGAAGGAGAAAGAAAAATCTGAGTTGGAGCTTAAAGACATTCCATAA