Details for Kale Locus Bo5g098820

Position : C5 ( 5`- 32112020 .. 32114102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098820

Protein [Map View]
MAQSCLKIVRLNNLKNRVNRRILILRRFTRLLWSRIVACAPRKSRRYLLLSRAATPSPSVSRPQPPPIPSLDASGGEAVR
RISVREHDNNHRRSDSDLVSLKISLLGDPEIGKTCFLAKYVGEDEEVEMRILDKGISCTDKMLSMGGARISYSIWELEGA
ERSRDLIPTACKDSVAILFMFDLTSRCTLNSVISWYQQARMSNQTAIPVMVGTKFDEFIQLPIDLQWTIASQARTYAKAL
NATLFFSSASYNINVNKIFKFVTAKLFDLPWTVERNLTIGEPLIDF*

DNA
ATGGCTCAGTCCTGTCTTAAGATCGTTCGACTAAACAATCTCAAGAACAGAGTGAACCGTCGGATTTTGATTCTCCGTCG
ATTCACGCGTCTTCTCTGGAGCAGAATCGTCGCTTGCGCTCCCAGAAAATCACGGAGATATCTCTTGCTGTCACGCGCCG
CCACTCCTTCTCCCTCTGTCTCTCGTCCTCAACCTCCTCCGATCCCCTCCCTTGATGCCTCTGGCGGTGAGGCCGTACGC
CGCATATCGGTACGCGAACACGATAATAATCACCGGAGATCGGATTCTGATCTGGTTTCTCTCAAAATCAGCCTCTTAGG
AGATCCCGAGATCGGCAAAACTTGCTTCCTGGCCAAATATGTTGGTGAAGATGAAGAAGTTGAAATGAGAATATTGGACA
AAGGGATCAGTTGTACGGACAAGATGTTATCCATGGGGGGTGCTCGCATCTCCTACAGTATCTGGGAACTAGAAGGAGCT
GAGAGATCACGGGATCTAATACCCACAGCTTGCAAGGACTCTGTAGCTATTCTCTTCATGTTCGATCTAACTAGTCGTTG
CACACTTAACAGTGTAATCAGCTGGTATCAACAAGCTAGAATGTCTAATCAGACGGCGATTCCAGTTATGGTAGGAACCA
AGTTTGATGAATTCATTCAGCTTCCTATTGATCTTCAATGGACTATTGCTAGCCAGGCGAGAACCTACGCGAAGGCGCTA
AACGCGACGCTCTTCTTCTCGAGTGCTTCATACAACATCAACGTAAATAAGATCTTCAAGTTTGTCACGGCGAAGCTCTT
CGACTTACCATGGACTGTGGAGCGGAATCTCACCATTGGAGAACCACTCATAGACTTCTAG