Details for Kale Locus Bo5g098810

Position : C5 ( 5`- 32109864 .. 32110238 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098810

Protein [Map View]
MMSFSCNSYVQNHAPFDHHDDDVDIDHHASDHQEESGWTTYLEDFSKQYRNHWEDSDHQDKSSCSLLGVSPSLVSDAATD
AFSGKSFPVKFSAKLTFGKARTKKICEDDSLEDTASSPVNSPKV*

DNA
ATGATGTCATTCTCTTGTAACTCTTATGTACAAAATCACGCCCCTTTTGATCATCACGATGATGATGTTGATATTGATCA
TCATGCTAGTGATCATCAAGAGGAGAGTGGATGGACAACTTATCTCGAAGATTTCTCAAAACAATACAGAAATCACTGGG
AAGATAGCGATCATCAAGACAAGAGTTCGTGTTCGCTTCTTGGCGTCTCTCCTTCTCTGGTCTCAGATGCCGCCACTGAC
GCCTTTTCCGGCAAGAGTTTTCCAGTTAAATTTTCGGCGAAGTTGACGTTTGGGAAAGCAAGAACCAAAAAGATTTGTGA
GGATGATTCTTTGGAGGACACGGCTAGCTCTCCGGTTAATAGCCCTAAGGTTTGA