Details for Kale Locus Bo5g098790

Position : C5 ( 5`- 32091560 .. 32095609 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098790

Protein [Map View]
MAASFSVPSMIMEEEGRFEGEVAEVQTWWSSERFKLTRRPYTARDVVALRGHLKQGYASNEMAKKLWRTLKSHQANGTAS
RTFGALDPVQVTMMAKHLDTIYVSGWQCSSTHTSTNEPGPDLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREER
AKTPFVDYLKPIIADGDTGFGGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVAVSEHINRLVAARLQFDV
MGTETVLVARTDAVAATLIQSNIDSRDHQFILGVTNPSLRGKSLSSLLAEGMAVGKNGPALQAIEDQWLSSARLMTFSDA
VVEALKRMNLSENEKSRRVNEWLNHARYENCLSNEQGRELAAKLGVTDLFWDWDLPRTREGFYRFQGSVTAAVVRGWAFA
QIADLIWMETASPDLNECTQFAEGVKSKTPEVMLAYNLSPSFNWDASGMTDQQMMEFIPRIARLGYCWQFITLAGFHADA
LVVDTFAKDYARRGMLAYVERIQREERSNGVDTLAHQKWSGANYYDRYLKTVQGGISSTAAMGKGVTEEQFKETWTRPGA
AGMGEGTSLVVAKSRM*

DNA
ATGGCTGCATCTTTCTCTGTCCCCTCTATGATCATGGAAGAGGAAGGGAGATTCGAGGGGGAAGTTGCGGAAGTGCAGAC
TTGGTGGAGCTCAGAGAGGTTCAAGCTAACAAGGCGTCCTTACACGGCCCGTGACGTGGTGGCTCTACGTGGCCATCTCA
AGCAAGGTTATGCTTCGAACGAGATGGCTAAGAAGCTGTGGAGAACGCTCAAGAGTCACCAAGCCAACGGCACGGCGTCT
CGCACGTTTGGTGCCTTGGACCCTGTTCAGGTGACAATGATGGCTAAACATTTGGACACCATTTATGTCTCTGGTTGGCA
GTGCTCGTCTACTCACACCTCCACTAACGAGCCTGGTCCGGATCTTGCTGACTATCCATACGATACCGTTCCTAACAAAG
TCGAACATCTCTTCTTCGCTCAGCAGTACCATGACAGAAAACAGAGGGAGGCGAGAATGAGCATGAGCAGAGAAGAAAGA
GCAAAAACTCCGTTTGTGGACTACTTGAAGCCCATCATCGCCGACGGAGACACCGGTTTCGGTGGCACTACCGCCACCGT
CAAACTCTGTAAGCTCTTCGTCGAGAGAGGCGCAGCTGGGGTCCACATCGAGGACCAGTCGTCCGTCACCAAGAAGTGTG
GCCACATGGCCGGAAAAGTCCTCGTGGCGGTAAGTGAACACATTAACCGCCTTGTCGCGGCTCGGCTCCAGTTCGATGTG
ATGGGCACAGAGACCGTTCTGGTCGCTAGAACGGATGCGGTGGCGGCTACTTTGATCCAGTCGAACATTGACTCGAGGGA
CCATCAGTTCATCCTCGGTGTCACTAACCCGAGCCTTAGAGGCAAGAGTTTGTCCTCGCTTCTGGCCGAGGGAATGGCTG
TAGGCAAGAACGGTCCAGCGTTGCAAGCGATTGAGGATCAATGGCTTAGCTCAGCTCGTCTCATGACTTTCTCGGACGCT
GTCGTGGAGGCTCTCAAGCGCATGAACCTAAGTGAGAATGAGAAGAGCCGGAGAGTGAACGAGTGGCTAAACCATGCAAG
GTACGAGAACTGCCTGTCAAACGAGCAAGGCCGAGAATTAGCAGCAAAACTCGGTGTGACTGATCTTTTCTGGGACTGGG
ACTTGCCCAGAACCAGAGAAGGATTCTACCGGTTCCAAGGCTCGGTCACAGCAGCCGTGGTCCGTGGCTGGGCCTTTGCA
CAGATAGCTGATCTCATCTGGATGGAAACCGCAAGCCCTGACCTCAACGAATGCACCCAATTCGCAGAAGGAGTCAAGTC
CAAGACACCAGAGGTAATGCTCGCCTACAACCTCTCCCCATCCTTCAACTGGGACGCTTCTGGTATGACGGATCAGCAGA
TGATGGAGTTCATTCCACGAATCGCCAGGCTCGGTTATTGCTGGCAGTTTATAACCCTTGCGGGTTTCCATGCGGATGCT
CTTGTGGTCGATACGTTTGCAAAGGATTACGCGAGGAGAGGGATGCTGGCTTATGTCGAGAGGATACAGAGAGAAGAGAG
GAGCAATGGGGTTGACACATTGGCTCATCAGAAATGGTCAGGTGCTAATTACTATGATCGTTATCTTAAGACCGTCCAAG
GTGGAATCTCCTCCACTGCAGCCATGGGCAAAGGTGTTACTGAGGAACAATTCAAAGAGACCTGGACGAGGCCGGGAGCT
GCTGGAATGGGCGAAGGGACTAGCCTTGTGGTGGCCAAGTCCAGAATGTAA