Details for Kale Locus Bo5g098760

Position : C5 ( 5`- 32052545 .. 32053896 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098760

Protein [Map View]
MAKLLVASDDRIFITLIIIPSQFSSDASSSYPKSEDRLLYFHLPVGDQTTQQTFISYIESQKPHVRAAVSELTKNVPKRS
GSRRRLAGIVLDIFCMSMIDVPDEFNLPAYTFYTSNASFLGLLFHVQSLYDNNKLDVSELKNSDAEFDVPTLTRPFPARC
LLSVIISKEWLPSVLARARTLRETKGILVNSSGGMEHQALKFFSDMKSNTPPVYAVGPILDFKTDDGDEKGSQILRWLDE
QPSRSVLFLCFGSMGWFGEKQVREIAVALERSCHRFLWSLRRPSHLGHMNCSPPEEFKNLEEILPEGFLDRTAKIGKIIG
WAPQTAVLGSHAIGGFVTHCGWNSILESVWFGVPTAAWPIFAEQQFNAFQMVEEELGLADSEMRKRVKEMKDKLRTALLD
GGSSMAALRMFVKDVVENIPKNAF*

DNA
ATGGCAAAGCTTCTTGTAGCCAGCGACGATCGCATTTTCATCACTCTCATCATCATTCCTTCACAGTTCTCCAGCGACGC
TTCTTCTTCTTACCCGAAGTCCGAAGACCGTCTCCTTTATTTCCACCTCCCTGTAGGAGATCAAACAACTCAGCAAACAT
TCATCTCTTACATAGAGAGCCAGAAACCACACGTCAGAGCCGCCGTATCGGAACTCACTAAGAACGTTCCTAAACGATCT
GGCTCGCGGCGCCGCCTCGCGGGGATTGTTTTAGACATATTCTGCATGTCCATGATAGACGTCCCGGACGAGTTTAACTT
ACCGGCTTATACATTCTACACGTCGAACGCTTCTTTTCTAGGACTCCTCTTCCATGTTCAGTCTCTTTACGACAATAACA
AGCTCGACGTAAGCGAGTTAAAGAACTCAGACGCTGAGTTTGACGTTCCCACTCTCACTCGTCCTTTTCCGGCAAGGTGC
TTGCTTTCAGTGATAATAAGCAAAGAATGGCTCCCATCTGTTTTGGCTCGAGCTAGGACGTTGAGAGAAACTAAAGGTAT
ATTAGTAAACTCGTCTGGGGGGATGGAACATCAGGCGCTAAAGTTTTTCTCCGACATGAAGAGTAATACTCCTCCGGTAT
ACGCGGTGGGACCAATCTTGGACTTTAAAACCGACGATGGAGATGAGAAAGGGTCGCAGATTTTACGTTGGCTAGATGAG
CAACCGTCGAGATCAGTGTTGTTCCTCTGCTTTGGAAGCATGGGATGGTTCGGTGAGAAACAAGTGAGAGAAATAGCTGT
GGCGCTTGAGAGAAGTTGCCACCGCTTCCTTTGGTCACTTCGACGCCCTTCTCATTTGGGACACATGAATTGTTCTCCTC
CCGAGGAGTTCAAAAACTTGGAGGAGATTCTCCCGGAAGGGTTTTTAGATAGGACGGCAAAGATTGGGAAGATTATAGGT
TGGGCTCCACAAACAGCTGTTCTTGGCAGTCACGCCATAGGAGGTTTCGTGACTCATTGTGGATGGAACTCGATTCTAGA
GAGTGTTTGGTTTGGTGTTCCGACAGCGGCCTGGCCTATCTTCGCTGAGCAACAGTTCAACGCGTTTCAAATGGTGGAGG
AGGAGCTTGGTTTGGCGGATAGTGAGATGAGGAAGCGGGTCAAGGAGATGAAGGATAAGCTCCGCACGGCGTTGCTGGAC
GGTGGATCTTCCATGGCTGCTCTTAGGATGTTTGTCAAGGACGTGGTCGAAAACATTCCTAAGAATGCATTTTGA