Details for Kale Locus Bo5g098530

Position : C5 ( 5`- 31789064 .. 31789962 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098530

Protein [Map View]
MYSSSSASKFVILIHVFAMQLLHINSELPLNTTNAYLNHKCLVSKGKYKPGSEYEKQLKLTIKNFYSDSGNKEGFTLLGS
DGFSAILQCRGDSYGSKCRDCYATAVAALHRRCPWYKAKIIWYDQCLLSFDTKYSTGQIDYDNNFCMSNAKKLGGDKLAF
IRTWNIFMDNLTTLAIRVDNNDTKTSPLYAVGETKFKGDMMYGMVQCTKDIPEKACEECLVFNSIHFQFCLNDKRGARFM
CRSCTFRFEFYPFIAKQVRNI*

DNA
ATGTACTCTTCATCGTCTGCATCAAAATTCGTCATTTTGATCCATGTCTTTGCCATGCAACTTCTCCATATAAACAGCGA
ATTGCCCTTAAACACGACCAATGCGTATCTCAACCACAAATGTTTGGTTAGTAAAGGAAAATACAAGCCGGGAAGTGAGT
ACGAGAAACAGTTAAAATTGACCATAAAAAATTTCTATTCCGACAGTGGCAATAAAGAAGGTTTCACCCTGTTAGGCTCT
GATGGTTTTTCCGCTATCCTCCAATGCCGCGGGGACTCCTACGGGAGCAAGTGCCGCGACTGCTATGCCACCGCCGTTGC
TGCGCTTCATAGGAGATGTCCGTGGTACAAGGCGAAAATAATATGGTATGACCAATGTCTTCTCTCGTTTGATACCAAAT
ATTCTACTGGGCAGATCGATTACGACAATAATTTTTGTATGTCGAACGCTAAGAAGTTGGGAGGAGATAAACTCGCGTTT
ATAAGGACTTGGAATATTTTCATGGACAATCTGACGACTTTAGCCATCCGTGTTGATAATAATGACACAAAAACATCACC
ATTGTACGCTGTGGGGGAGACGAAGTTCAAGGGTGATATGATGTATGGAATGGTGCAATGTACGAAAGACATACCCGAAA
AAGCTTGTGAGGAGTGTTTGGTGTTTAATAGCATTCATTTTCAATTTTGCTTGAATGATAAACGAGGAGCGAGATTTATG
TGTAGAAGCTGTACTTTTAGGTTTGAGTTTTACCCTTTTATTGCCAAGCAGGTCCGAAATATTTAA