Details for Kale Locus Bo5g098430

Position : C5 ( 5`- 31653315 .. 31654187 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098430

Protein [Map View]
MESCYEFASLSELPPLPQAYAPMEEYYPYDIAPLESLPPFPHSDFAPHGGLIPFSDTHQDYLQLQKQQHCAESMFTDSSL
PLVTRDYLTESTRFENLFSHDVPFLHLPDLKFVEGARSPPPCLSLAPPPPLPVARHNVNLRQRHVGSRVNNTFSISPSSS
SKSKPPASQYVHGTRKVSDRIRSLEKIMPWEKKMSLATTLEETNKYITFLQSQIASLRWMPLDSVYPTKPREEHVGETTS
LLNSLTRQQLLQVIANSPGSRNVLYKQGVCVFSYEQLLSVKMMAESARNL*

DNA
ATGGAGTCCTGTTATGAGTTCGCATCGCTCTCTGAGTTACCGCCGCTTCCACAAGCGTACGCTCCCATGGAGGAGTATTA
TCCTTACGACATTGCTCCTCTCGAATCCTTACCACCGTTTCCTCACTCCGATTTCGCTCCTCACGGCGGCTTGATCCCTT
TCTCCGACACGCACCAAGACTATCTCCAGCTCCAGAAACAACAACACTGTGCAGAATCAATGTTCACAGACTCGTCTCTG
CCGCTCGTCACTCGCGACTACCTCACCGAGTCGACTCGGTTCGAAAACCTCTTCTCCCATGACGTTCCGTTTCTCCACTT
GCCAGATCTCAAATTCGTGGAAGGCGCGAGGTCGCCGCCGCCGTGTCTCTCTCTCGCTCCTCCTCCTCCTCTCCCGGTGG
CTAGACACAACGTTAACCTGAGACAGCGTCACGTTGGCTCGCGAGTCAACAACACCTTCTCTATCTCGCCGTCTTCCTCT
TCTAAATCTAAACCTCCGGCGTCTCAGTATGTTCACGGTACAAGGAAGGTGTCAGACAGAATCAGATCCTTGGAGAAAAT
CATGCCGTGGGAGAAGAAGATGAGTTTGGCTACGACTCTCGAGGAAACGAACAAGTACATCACCTTCCTCCAGTCTCAGA
TCGCTTCTCTCCGTTGGATGCCTCTGGATTCCGTCTACCCAACCAAACCCCGAGAAGAGCACGTAGGAGAAACCACCAGT
CTGCTCAATTCTCTGACGAGACAACAGCTTCTCCAGGTGATTGCCAACTCTCCGGGGTCACGAAACGTGCTCTACAAGCA
AGGTGTTTGCGTCTTCTCATATGAACAGCTTCTCTCCGTCAAGATGATGGCTGAATCGGCTAGAAACCTCTGA