Details for Kale Locus Bo5g098410

Position : C5 ( 5`- 31642203 .. 31644546 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098410

Protein [Map View]
MESCSVLEVDINGEETIFLNKQIICKYSGTLKKLLGKSTCFSSGNLKVIFNDFPGGAESFELLSRFCYNNCEWTVMPSNL
VFLHCAAKFMEVTKVLAQTEKCMEEIRYWAWPEVLLSLKQCQELETSSEAESLAVKLMDALVEKLCLAIEASPSSAACSP
SPDSSLFRFSCDSKSTESFKNSSSRTTWWFDEVLVLSPGLVKTFLKLVVLRKFDNVTIARFLFYYQKVKFCSASSNEKRE
ILETTVDTLYVLDRSCVPYKSLFGVLRLALGLHIDKSVMNKLEVMIGQQLEQATLDNLLVPSPSKSSHLYYVNLVLRFAK
AFFDGGKRGSSQMKKVATLIDQYVAEVAPDPCLKPSKFLSLLTLVPDSARESHEDIYRAIDMYLEAHAGLTNGERLNLIR
TLSYEKLPVQSRAHMSCNTKFQEIETLDDEQQQERKQLVLRVKKVESSGDSEKLKEHIEGIQWRVMELERACLKMQTQME
VIKKRTKGTSRGSNRSLPKLCS*

DNA
ATGGAATCTTGCTCTGTTCTTGAAGTAGACATCAACGGAGAAGAAACTATCTTTCTCAATAAGCAAATCATATGCAAGTA
TTCTGGAACATTGAAGAAACTGCTTGGGAAGTCTACTTGTTTTTCCAGTGGTAATCTCAAGGTGATCTTTAATGACTTCC
CTGGTGGAGCTGAGAGTTTCGAGCTTTTGTCAAGATTCTGCTACAACAACTGTGAATGGACTGTGATGCCTTCAAACCTA
GTCTTCTTGCATTGTGCTGCTAAGTTCATGGAAGTCACTAAAGTCTTGGCACAAACTGAGAAGTGTATGGAGGAGATTCG
GTACTGGGCATGGCCAGAGGTTCTTCTTAGTTTGAAACAGTGCCAAGAACTTGAAACATCCTCCGAGGCTGAGTCTTTAG
CCGTTAAGTTGATGGATGCGCTGGTGGAGAAACTGTGTTTAGCCATTGAAGCGAGTCCCTCTAGCGCTGCTTGCTCGCCT
TCACCGGATAGCAGCTTGTTTCGGTTCTCTTGTGACAGTAAAAGCACAGAGAGTTTCAAGAACAGCTCTTCGAGGACAAC
ATGGTGGTTCGATGAGGTTCTTGTTCTAAGTCCTGGCTTGGTTAAAACGTTCTTGAAGCTGGTGGTGTTGAGGAAGTTCG
ATAACGTTACCATCGCTAGGTTCTTGTTCTATTACCAGAAGGTCAAGTTCTGTTCAGCGTCATCAAATGAGAAAAGAGAG
ATTCTTGAAACGACCGTTGATACTCTCTACGTGTTGGACCGAAGCTGTGTTCCTTACAAGAGTCTTTTCGGTGTTTTGAG
GCTTGCTCTTGGGTTACACATAGACAAAAGTGTTATGAACAAGCTTGAGGTTATGATTGGTCAGCAACTGGAACAAGCAA
CACTCGACAACCTCCTTGTTCCATCTCCATCGAAGTCTAGTCACTTGTACTATGTGAATCTTGTTCTTAGATTCGCAAAA
GCTTTCTTTGACGGAGGGAAAAGAGGATCATCACAGATGAAGAAAGTGGCGACGTTGATTGATCAGTACGTAGCTGAAGT
GGCACCTGATCCTTGCTTGAAACCTTCAAAGTTTTTGTCTCTCCTCACACTCGTTCCTGATTCAGCTAGAGAGTCTCATG
AAGATATCTACCGTGCTATTGACATGTATCTGGAGGCACATGCAGGATTAACCAATGGTGAAAGACTCAACTTGATAAGA
ACTTTGAGTTACGAGAAGCTTCCAGTGCAGTCAAGAGCACATATGTCGTGTAACACAAAGTTTCAGGAGATTGAGACATT
AGATGATGAGCAGCAACAAGAGCGGAAGCAGCTCGTACTCAGAGTGAAGAAGGTCGAGAGTTCAGGAGACAGTGAGAAGT
TGAAAGAACATATAGAAGGGATACAGTGGAGGGTAATGGAGTTGGAGAGAGCGTGTTTGAAAATGCAGACTCAGATGGAA
GTTATCAAGAAGAGAACCAAGGGCACTAGTAGAGGAAGCAACAGATCGCTTCCTAAGCTCTGTTCTTGA