Details for Kale Locus Bo5g098320

Position : C5 ( 5`- 31566176 .. 31567183 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098320

Protein [Map View]
MGSHTQNLSFLILLLLGFLAVSFACECSPPKPSPSPHKPPKHPVKPPKPPAAKPPKPPAVKPPKPPTKPPTLKPHPHPKP
PTKPPTVRPHPHPKPPTKPHPIPKPPTVKPPPSTPKPPTKPPTVKPPTVKPPPSTPKPPTKPPTLKPPPSTPKPPTKPPT
VKPPPSTPKPPTHKPPTVCPPPTPTPTPIPPVVTPPTPPTPTPPVVTPPTPAPPVVTPPTPTPTPPVVTPPTPTPPVVTP
PTPTPPKPETCPIDTLKLGACVDVLGGLIHIGLGGSSAKKECCPVLGGLVDLDAAVCLCTTIKAKLLNLDLIIPIALELL
IDCGKTPPPGFKCPS*

DNA
ATGGGGTCTCACACACAAAACCTCTCTTTTCTTATCCTCCTTCTCCTAGGCTTCCTTGCTGTCTCATTCGCTTGCGAATG
TAGCCCTCCTAAACCATCACCGAGCCCCCACAAACCGCCTAAACATCCCGTCAAACCGCCTAAACCACCAGCAGCCAAAC
CACCAAAACCACCGGCAGTAAAACCTCCTAAACCCCCCACCAAACCTCCCACCCTTAAACCACACCCCCACCCTAAACCT
CCCACTAAACCCCCCACCGTTAGACCACACCCACACCCTAAGCCCCCTACCAAACCTCATCCCATCCCAAAACCGCCCAC
CGTTAAACCACCACCCTCCACCCCCAAACCGCCCACCAAACCACCCACCGTTAAACCACCCACCGTTAAACCACCTCCAT
CCACCCCTAAGCCGCCCACCAAACCACCCACCCTCAAACCACCACCCTCCACCCCAAAACCGCCCACCAAGCCACCCACC
GTCAAACCACCTCCGTCCACCCCTAAACCACCTACCCACAAGCCACCAACAGTGTGCCCACCGCCAACACCAACACCAAC
ACCAATCCCACCTGTTGTAACGCCACCAACACCACCAACACCAACTCCACCAGTCGTTACGCCACCAACACCAGCCCCAC
CTGTTGTAACGCCACCAACACCAACACCAACACCACCGGTCGTAACGCCACCGACACCAACCCCTCCTGTCGTAACACCA
CCAACACCAACTCCACCTAAGCCAGAAACGTGCCCAATCGACACGTTGAAGCTAGGCGCTTGTGTAGACGTTCTTGGAGG
TTTGATTCACATCGGGCTTGGTGGAAGTAGCGCCAAGAAAGAGTGTTGTCCGGTTTTGGGAGGCTTAGTTGACTTAGACG
CAGCCGTTTGTCTATGTACCACCATTAAAGCCAAACTTCTCAACCTCGACCTTATTATCCCCATTGCTCTTGAGCTTCTT
ATCGACTGTGGAAAGACTCCGCCACCTGGCTTCAAATGTCCCTCTTGA