Details for Kale Locus Bo5g098300

Position : C5 ( 5`- 31502298 .. 31504766 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098300

Protein [Map View]
MAGSALPLPPPPPLSFHSPPPNQTRRSSTFAPPTNPTPQTPSIRSRLSRICQEGNPQLARQLFDAIPKPTTVLWNTIIIG
LICNNLPHEALLFYSRMRKTAPFTKCDPYTYSSTLKACAETKNLKAGKAVHCHLIRCLQNSSRVVHNSLLNMYVSCLNHP
PPGSEYDVVRKVFDSMRRKNVVAWNTLVSWYVKTERHAEACRQFGIMMRMEIKPSPVSFVNVFPAVASSRSVKRAKVFYG
LMLKLGDEYVKDLFVVSSAISMYAELSDIEASRRVFDSCVERNIEVWNTMIGVYVQNEYLVESIDLVLDAIGSKEIVSDE
VTFLLAASAVSALQQVELGRQFHGFVSKNFQELPVVIFNSLMVMYSRCGSVHESFAVFVSMRERDVVTWNTMISAFVQNG
LDDEGLMLVYEMQKQGFKIDYITVTALLSAASNLRNKEIGKQTHGFLIRQGIQFEGMNSYLIDMYAKSGLIRISEKLFER
SGYAERDQATWNSMMSGYTQNGHTEETFAVFRKMLEQNIKPNAITVASILPACSQIGSFDLGKQLHGFSIRQYLDQNVFV
ASALVDMYSKSGAIQYAENMFYQTKERNSVTYTTMILGYGQHGMGERAISLFRSMEESGVKPDTVTFVAVLSACSYSGLV
DEGLKIFEEMSEVYNIQPSNEHYCCVTDMLGRVGRVDEAYEFVKGLDEEGNIAELWGSVLGACRVHGEIELAETVSEKLA
KVDKGKNFSGYQVLLSNVYAEEQKWTSVDRLRRGMREKGLRKEVGRSGIEVAGNVNCFVSRDQEHPQSDEIYDVIEGLAK
DMRGDSHLTTFPMVTPSLELEE*

DNA
ATGGCCGGATCAGCTCTACCTCTCCCACCACCACCGCCACTTTCGTTCCACTCTCCCCCGCCAAACCAAACCCGCCGCTC
TTCCACCTTCGCCCCACCAACAAACCCAACTCCCCAAACACCTTCAATCCGCTCCCGCCTCAGCAGAATCTGCCAAGAAG
GAAACCCACAGCTCGCACGCCAGCTGTTCGACGCAATTCCCAAACCAACAACCGTCCTATGGAACACCATTATCATCGGC
CTCATCTGCAACAATCTCCCGCACGAGGCTCTCCTTTTCTACTCCCGGATGAGAAAGACCGCTCCTTTCACCAAATGCGA
CCCTTACACTTACTCCTCCACGCTCAAGGCCTGCGCCGAGACCAAGAACCTGAAGGCTGGTAAAGCCGTGCATTGCCATT
TGATCCGGTGCTTGCAGAACTCGAGCAGGGTTGTTCATAACTCTCTGTTGAATATGTACGTTTCTTGCTTGAACCACCCT
CCTCCTGGAAGCGAGTACGATGTGGTGCGTAAGGTTTTTGATAGTATGCGTAGGAAGAACGTTGTGGCGTGGAATACGTT
GGTTTCTTGGTATGTGAAGACGGAGAGACACGCAGAGGCGTGTAGGCAGTTTGGGATTATGATGAGGATGGAGATTAAAC
CGAGTCCGGTTAGCTTTGTGAATGTCTTCCCCGCGGTGGCGAGTTCGAGAAGTGTTAAGAGAGCTAAAGTATTTTATGGT
TTGATGCTTAAGTTGGGAGATGAGTATGTGAAGGACTTGTTTGTTGTGAGCTCGGCTATTTCTATGTATGCAGAGCTTAG
CGATATTGAAGCGTCACGGAGAGTGTTTGATTCTTGTGTAGAGAGGAACATTGAGGTGTGGAATACAATGATAGGAGTCT
ATGTTCAGAACGAGTACCTGGTTGAGAGTATAGATCTTGTTCTTGATGCAATAGGATCGAAAGAGATTGTGTCTGACGAA
GTAACGTTCCTCTTGGCAGCGAGTGCAGTTTCAGCGCTGCAGCAAGTGGAGTTAGGTAGACAGTTTCATGGTTTTGTCAG
CAAGAACTTTCAGGAGCTTCCCGTTGTGATATTCAACTCGTTGATGGTGATGTACTCGAGGTGCGGCTCTGTGCACGAGT
CCTTTGCGGTCTTTGTTTCGATGCGAGAGAGAGATGTTGTGACGTGGAACACAATGATCTCTGCGTTTGTCCAAAACGGC
TTAGATGATGAAGGATTGATGTTGGTGTATGAGATGCAGAAGCAGGGGTTTAAGATCGATTACATAACAGTGACTGCTTT
GCTTTCGGCTGCGTCGAATCTTAGAAACAAGGAGATTGGGAAGCAGACTCATGGTTTCCTTATAAGGCAAGGGATTCAGT
TCGAGGGGATGAACAGTTACCTTATTGACATGTATGCTAAGTCAGGTCTAATAAGGATCTCAGAGAAGCTTTTCGAGAGA
AGTGGCTATGCTGAAAGAGATCAAGCTACTTGGAACTCTATGATGTCCGGGTACACGCAGAACGGACACACAGAGGAAAC
GTTTGCTGTGTTCAGGAAGATGTTAGAACAGAATATCAAACCCAATGCCATAACTGTGGCGTCGATTCTCCCTGCGTGTA
GCCAGATAGGTAGTTTCGACTTAGGTAAACAGCTACATGGTTTCTCTATAAGGCAGTACTTGGATCAGAACGTATTTGTT
GCTTCTGCGTTAGTTGATATGTACTCAAAGTCAGGAGCGATACAGTACGCAGAAAACATGTTTTACCAAACGAAAGAGAG
AAACTCTGTGACGTACACCACGATGATATTGGGGTATGGTCAACACGGAATGGGTGAGAGAGCTATCTCGCTGTTTCGTT
CAATGGAAGAGTCTGGAGTCAAACCAGATACTGTCACCTTTGTTGCAGTATTATCAGCTTGCAGCTATTCCGGTTTAGTG
GATGAAGGTCTCAAAATATTCGAGGAAATGAGTGAAGTTTATAACATCCAGCCTTCCAATGAGCACTATTGCTGCGTTAC
AGACATGTTAGGGAGAGTAGGCCGCGTTGATGAAGCCTACGAGTTTGTTAAAGGGCTTGATGAAGAAGGAAACATTGCTG
AGCTATGGGGTTCGGTTCTGGGAGCTTGTAGAGTACATGGTGAGATTGAGCTTGCTGAAACTGTTTCAGAGAAGTTAGCT
AAAGTGGATAAAGGGAAGAACTTTTCAGGATATCAGGTTTTGCTCTCGAATGTGTATGCTGAGGAACAGAAATGGACGAG
TGTTGATAGGTTGAGGAGAGGAATGAGAGAAAAGGGTTTAAGGAAAGAAGTTGGTCGTAGTGGGATTGAAGTTGCAGGTA
ATGTAAATTGTTTTGTGTCTAGAGATCAAGAGCATCCTCAGAGTGATGAGATATACGATGTCATTGAGGGTTTGGCTAAA
GATATGAGAGGCGATTCGCATCTGACAACATTCCCTATGGTTACCCCAAGTTTGGAATTAGAGGAGTGA