Details for Kale Locus Bo5g098270

Position : C5 ( 5`- 31483167 .. 31485139 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098270

Protein [Map View]
MGASGRWIKALVGFTKSDKSKSKKKDDNVKTATKSRSGRNHSVDFDAEKFQLGFEDSNTHSSMLDNGVSTSTSYGASNEE
QRKEHMAATRIQTAFRGFLARRALRALKGLVRLQALVRGHAVRKQAAVTLRCMQALVRVQARVRARRVRLALESETGPQI
LQQQLADEARVREIEEGWCYSIGSVEQIQAKILKRQEAAAKRERAMAYALTHQWQAGTRQLSAHSGFQPDKNNWGWNWLE
RWMAVRPWENRFLDSNLRDDAILAENNMELSENVVHKTQMKIASKIPNTSNLASGVSSQKVTGPSLSDGNSSSPGISSSM
PVPVVSKDRSKLAKDDLAVEVVNSRPGAGPRSHSNPKERSRAPDKASKERLSLPNSGKSLGPQSAKAKSSQNQKRRNSDP
IKQRLA*

DNA
ATGGGTGCTTCTGGGAGATGGATTAAAGCATTGGTTGGTTTCACCAAGTCTGATAAGTCAAAGTCTAAAAAGAAGGATGA
TAATGTGAAGACTGCAACCAAGAGCCGGTCTGGGAGAAACCATTCTGTTGATTTTGATGCTGAAAAGTTTCAACTTGGAT
TTGAAGATTCCAATACGCATAGCAGCATGTTAGATAATGGGGTCTCCACTTCAACTTCTTATGGTGCTTCTAATGAAGAA
CAAAGGAAGGAGCATATGGCTGCAACTCGGATTCAAACAGCTTTTCGAGGATTCCTGGCTAGAAGGGCTTTACGAGCATT
GAAGGGATTGGTTAGACTTCAGGCCCTTGTTAGAGGACACGCGGTGAGAAAGCAAGCTGCTGTAACGCTTCGATGCATGC
AAGCGTTAGTAAGAGTTCAGGCTCGTGTTCGCGCAAGACGTGTTCGTCTCGCCTTGGAAAGTGAAACGGGTCCGCAGATT
CTTCAGCAACAGCTTGCAGATGAAGCCAGGGTTCGAGAAATAGAGGAAGGTTGGTGTTATAGCATTGGTTCTGTTGAACA
AATCCAAGCCAAGATACTAAAGAGGCAGGAAGCTGCAGCTAAGCGTGAGAGGGCTATGGCATACGCTTTGACTCACCAGT
GGCAAGCAGGAACTCGGCAGTTATCTGCGCACAGTGGTTTTCAGCCTGACAAAAACAACTGGGGATGGAACTGGCTAGAA
AGATGGATGGCTGTTCGTCCATGGGAGAATCGGTTTCTTGACAGCAACCTCAGGGACGATGCCATATTAGCTGAAAACAA
TATGGAGCTGTCTGAGAATGTTGTGCATAAAACTCAGATGAAGATTGCAAGCAAGATTCCAAACACTTCAAATCTTGCGT
CCGGTGTTTCGAGTCAGAAGGTAACCGGGCCATCTCTGTCAGATGGTAATTCGTCTTCACCTGGAATATCTTCAAGCATG
CCGGTGCCAGTGGTGTCCAAGGATAGGTCAAAGCTCGCTAAAGACGATCTTGCTGTAGAAGTTGTTAACTCAAGACCTGG
TGCTGGTCCAAGATCACACAGCAATCCAAAAGAAAGATCAAGAGCGCCAGATAAAGCTTCTAAGGAGCGGTTATCTCTGC
CAAACAGTGGAAAATCCTTGGGACCTCAGTCAGCTAAAGCCAAATCTTCCCAAAACCAGAAAAGACGCAACTCCGATCCA
ATAAAACAGAGGCTTGCATAG