Details for Kale Locus Bo5g098200

Position : C5 ( 5`- 31429957 .. 31430364 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098200

Protein [Map View]
MVKFLKQNKAVILLQGRYAGKKAVIIRSFDDGNRERPYGHCLVAGLKKYPSKVIRKDSAKKTAKKSRVKCFIKVVNYQHL
MPTRYTLDVDLKEVATVEALASKDKKVAALKEAKAKLEERFKTGKNRWFFTKLRF*

DNA
ATGGTTAAGTTCCTGAAGCAGAACAAAGCTGTGATCCTCCTCCAAGGCCGTTACGCCGGCAAGAAGGCAGTGATCATCCG
CTCCTTCGACGACGGAAACCGTGAGCGTCCTTACGGACACTGCCTCGTCGCGGGACTGAAGAAGTATCCGAGCAAGGTCA
TCCGCAAGGACTCAGCCAAGAAGACGGCGAAGAAATCTCGAGTCAAGTGCTTCATAAAGGTCGTGAACTACCAGCATCTG
ATGCCTACTCGTTACACATTGGACGTGGATCTGAAGGAGGTTGCGACTGTGGAAGCTCTGGCTTCGAAGGACAAGAAGGT
GGCGGCTCTCAAGGAGGCTAAGGCTAAGCTCGAGGAGAGGTTCAAGACTGGAAAAAACAGGTGGTTCTTTACCAAGCTTA
GGTTCTGA