Details for Kale Locus Bo5g098170

Position : C5 ( 5`- 31395419 .. 31398101 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098170

Protein [Map View]
MLGKRLSHLDSIPHTPRVNNQIPDLNDATLDHELLSVRLATYGLAELQMEWKLPALADQLFRNPDYHKHVRKHIVKQLKK
QRKLYEGYVPMKYRHYTRKMKKPGEWGDHVTLQTAADRFKAKICLVTSFREQSYIEILPHNKNPLREAWLSFWSEVHYNS
LYSSGDVPTRQYRKKHWLF*

DNA
ATGCTTGGGAAGAGACTCTCTCATTTAGATTCTATACCACACACTCCTCGTGTTAACAATCAAATACCCGATTTAAATGA
TGCAACATTAGACCATGAGCTGCTCTCTGTGAGGTTGGCCACATATGGTTTAGCTGAACTACAGATGGAATGGAAATTGC
CAGCTCTAGCAGACCAGCTTTTCCGTAATCCAGATTACCATAAGCATGTTAGGAAGCATATTGTAAAGCAGTTGAAAAAG
CAACGAAAGTTATACGAAGGATATGTGCCGATGAAATACAGACACTACACCAGGAAGATGAAAAAACCGGGTGAATGGGG
AGATCATGTTACTCTTCAGACTGCTGCAGATCGTTTTAAAGCGAAGATATGCTTAGTCACATCATTCCGGGAACAATCCT
ACATTGAGATACTTCCCCATAACAAGAATCCTCTTAGAGAGGCTTGGCTTAGCTTCTGGAGCGAAGTGCATTACAATTCG
CTATACTCTAGTGGAGATGTTCCCACAAGACAATACAGGAAGAAGCATTGGCTCTTCTAG