Details for Kale Locus Bo5g098160

Position : C5 ( 5`- 31389759 .. 31392805 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098160

Protein [Map View]
MERSDSRDLYNFVRSSSDSNSKLFDASQYEFFGQNLDEMSLGGIDDDEVVAPVLGHTSPDDDEYHLFNKGEGAGLGSLSD
MDDLATTFAKLNRNVTGPKHLGVIGDRGSGSFSRESSSATDWTHDTELTNWLDEQDQEANRWSSQPQSSAHSQPLYRTSS
YPQQPPPLQHYNSEPIIVPESTFTSFPPPGSRSQQTSPGSLHRAPSLPSGSQMNFTPPSPLSNSRFHLSGPSHGPHYGGN
LARYASCGPTLGNVVQPHWVTDPGLLHGDHSGLLHSLAQQQQFPPRIDLMSQHMMALQQRQSYAQLAALQSQLYRSYPSP
SRKVSFGGGEVREQHKHKSSHRSRKNKGISQQASDAASQKSESGLQFRSKYMTSEEIESILKMQHSNSHSNDPYVNDYYH
QARLAKKSSGSSRAITLFYPSQLKDHHHQPKSRNNSSEQHQQQVHVDALGKITLPYIRRPRALLEVDSSSSPGSNDQKGS
GKHLEQEPLVAARVTIEDALGVLIDIVDIDRTLQSTRPQDGGAQVKRKRQILLEGLATALQLADPFSKTGQKSGLTAKDD
VVFLRIATLPKGRKMLTKYIQLLVPGTEIARVVCMAIFRHLRFLFGGLPSDTLAAETIANLAKAVTVCVQAMDLRALSAC
LAAVVCSSEQPPLRPIGSSSGDGASVVLISLLERAAEVVVVPRAVHGSSNDGLWRASFNEFFNLLTKYCRSKYETIRRQN
QGSAADVLELAIKREMPAELLRASLRHTNDDQRNYLLNFGRKPSAVSESASHARGGQINSESVMG*

DNA
ATGGAGAGATCTGATTCCAGGGACTTGTACAACTTTGTTCGCTCTTCCTCAGATTCAAATAGTAAGCTCTTTGATGCATC
TCAGTATGAGTTTTTTGGGCAAAACCTTGACGAAATGTCATTAGGAGGCATTGACGATGACGAAGTGGTCGCTCCTGTTC
TTGGACATACTTCTCCTGATGATGACGAGTATCACTTGTTTAATAAAGGAGAGGGTGCAGGTTTAGGGTCATTATCTGAC
ATGGATGATCTTGCCACGACTTTTGCAAAGCTAAATAGAAATGTCACAGGACCCAAACACCTTGGAGTTATTGGTGACAG
AGGATCTGGTTCCTTTTCAAGAGAGAGTTCTTCTGCCACCGATTGGACTCACGATACAGAGCTCACAAACTGGTTGGACG
AGCAAGATCAAGAGGCTAACAGATGGTCCTCGCAGCCACAGTCATCTGCTCATTCACAACCTTTATACAGGACATCCTCT
TACCCTCAGCAGCCACCACCGTTGCAACACTACAATAGTGAACCAATCATTGTACCAGAATCAACTTTCACCTCCTTTCC
CCCGCCAGGCAGCAGATCTCAGCAGACTTCACCTGGAAGCCTCCACCGCGCTCCTTCTCTTCCCAGCGGTTCTCAGATGA
ATTTCACCCCACCTTCCCCGCTGTCAAACTCTAGATTTCATCTTTCAGGACCCTCACACGGGCCTCACTATGGTGGTAAT
TTGGCTAGATATGCCTCGTGTGGTCCTACCCTTGGTAACGTTGTGCAACCTCATTGGGTCACTGATCCTGGTCTTCTCCA
CGGAGATCATTCTGGTTTATTACATAGTCTGGCGCAACAACAACAATTCCCTCCTCGAATTGATCTTATGTCGCAACATA
TGATGGCTCTCCAGCAGAGACAATCGTATGCTCAGCTTGCAGCGCTACAGTCTCAGCTGTACAGGTCTTATCCATCACCA
TCACGTAAAGTCTCTTTTGGGGGTGGTGAAGTTAGGGAACAACACAAGCATAAGTCTTCTCATAGGAGTCGAAAGAACAA
AGGCATATCTCAACAGGCATCAGACGCAGCTAGTCAGAAAAGCGAGAGTGGATTGCAGTTTAGATCAAAGTACATGACTT
CAGAGGAAATAGAGAGTATACTCAAGATGCAGCACTCTAATTCACACAGCAACGATCCTTATGTCAATGATTATTACCAC
CAAGCTCGCCTTGCCAAGAAGTCTTCTGGATCTAGTAGAGCAATCACTCTCTTCTACCCTTCTCAGTTGAAAGACCACCA
CCACCAACCTAAGTCCCGTAATAATAGTTCTGAACAGCATCAACAACAAGTTCATGTAGATGCTCTTGGGAAGATCACGC
TTCCCTATATTCGCAGGCCACGTGCCTTGCTTGAGGTTGACTCTTCTTCTTCTCCTGGTTCTAATGATCAAAAGGGCTCA
GGGAAACATTTGGAGCAGGAACCACTTGTGGCAGCTAGGGTTACAATTGAAGATGCTCTAGGAGTTCTTATCGACATAGT
TGACATTGACAGGACTCTCCAGTCCACAAGGCCTCAAGACGGAGGCGCTCAGGTGAAGAGAAAACGCCAGATCCTCCTTG
AAGGTCTAGCGACGGCACTTCAGCTTGCTGATCCGTTCAGCAAAACCGGTCAGAAGTCAGGGCTGACTGCTAAGGATGAT
GTTGTGTTTCTGCGTATAGCAACTCTTCCAAAGGGTCGGAAAATGCTTACGAAGTACATACAGCTTCTAGTTCCAGGCAC
TGAGATTGCTCGAGTTGTCTGTATGGCTATATTCCGCCACTTGAGGTTTCTCTTCGGCGGCTTGCCTTCGGATACTCTAG
CAGCAGAGACGATTGCTAATCTTGCCAAGGCAGTCACGGTCTGTGTTCAAGCTATGGACCTCCGAGCGCTGAGTGCTTGC
CTTGCAGCTGTGGTTTGTTCTTCAGAGCAGCCACCTCTGCGTCCTATTGGAAGCTCTTCTGGGGATGGTGCTTCGGTTGT
CTTGATATCACTTCTCGAGAGAGCTGCTGAAGTAGTGGTGGTTCCTCGAGCCGTCCATGGGAGCTCTAATGATGGCCTAT
GGAGAGCCTCGTTTAATGAGTTCTTCAACCTGCTTACTAAATACTGCAGGAGCAAGTATGAGACGATCCGTAGGCAGAAC
CAAGGGAGTGCAGCGGATGTTTTGGAGCTGGCGATAAAGAGAGAAATGCCCGCTGAGCTTTTACGTGCGAGCCTCCGTCA
TACCAATGACGACCAGAGGAACTATTTGTTAAACTTTGGTCGTAAACCGTCGGCCGTTAGTGAGTCTGCGTCGCATGCAA
GGGGTGGTCAGATCAACTCTGAATCTGTGATGGGTTGA