Details for Kale Locus Bo5g098140

Position : C5 ( 5`- 31382834 .. 31383377 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098140

Protein [Map View]
MENCSLDLCLSPVTSSLQSCHRDSKVSQSLATRTKEINAFYNGRVREYDLVEIQIRAVIEMASKERDITVLELAPVRLES
PLVFPVKRSVERFLEKRKKRSKYVTTPYSYTCSSTSSSSSHHF*

DNA
ATGGAGAATTGCAGCTTAGATCTCTGCCTATCTCCAGTGACCTCTTCACTTCAATCTTGTCACCGAGATTCCAAGGTTAG
TCAATCTTTAGCCACGAGAACTAAGGAGATCAATGCATTCTATAATGGGAGAGTACGAGAATACGATCTCGTAGAGATCC
AGATAAGGGCGGTAATAGAGATGGCGAGCAAGGAGCGTGACATAACGGTGTTAGAGTTAGCACCGGTTAGACTAGAATCG
CCCTTAGTGTTTCCGGTGAAGAGATCAGTGGAGAGGTTTTTGGAGAAGAGAAAGAAGAGAAGCAAATATGTTACTACACC
TTACAGTTACACTTGCAGCTCCACGTCTTCCTCCTCTTCGCATCATTTCTAA