Details for Kale Locus Bo5g098120

Position : C5 ( 5`- 31371296 .. 31372074 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098120

Protein [Map View]
MIGVLRRSSLPSRHALSAALTSFDSGLSLNITSAATGASVKLNLVGNGSTLSSASFVISARDFHIRSEPSMVSPAKISFR
GYATGSESSIGDSAKIKISPENVKPLSKKKKGGGESTSKIKGTRICIAIRSFDNPEKEAWCLPPHSRYAAMPDTRTLYTV
LRSPHVDKKSREQFEMRFKKRFLVIKAQSHELSNKLFWLKRYRILGAQYELQFHCKTRLDMSPVLGSK*

DNA
ATGATCGGAGTACTCCGCAGATCTTCCTTGCCGTCGAGGCATGCTCTCTCCGCCGCGCTGACCTCTTTTGACTCGGGTCT
CTCACTCAATATCACTTCAGCCGCCACCGGAGCCTCCGTGAAGCTGAATCTGGTTGGGAATGGATCTACTCTCTCCTCCG
CATCGTTCGTTATCAGCGCGAGGGACTTCCACATCAGATCTGAGCCTTCTATGGTTTCCCCGGCGAAGATCTCGTTTCGA
GGTTACGCCACAGGGAGTGAAAGCAGCATCGGAGATTCAGCTAAGATCAAAATCTCTCCGGAGAATGTCAAACCATTGAG
CAAGAAGAAGAAAGGAGGAGGAGAAAGCACATCAAAGATCAAAGGAACGAGGATCTGCATTGCGATCCGTTCATTCGATA
ACCCGGAGAAGGAAGCTTGGTGTCTTCCTCCTCACAGTCGCTACGCCGCCATGCCCGACACAAGGACCTTGTACACGGTG
CTTCGTTCCCCTCACGTCGACAAGAAGTCCAGAGAGCAGTTCGAGATGAGGTTCAAGAAACGGTTTCTTGTCATCAAAGC
TCAGAGCCACGAGCTTAGCAACAAGCTGTTTTGGTTGAAGCGTTACCGTATCCTCGGAGCTCAGTACGAGCTGCAGTTCC
ACTGCAAGACCCGTTTGGATATGTCTCCTGTGTTAGGCAGCAAGTGA