Details for Kale Locus Bo5g098110

Position : C5 ( 5`- 31368018 .. 31370342 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098110

Protein [Map View]
MISTVLRRSVLGASRRTQTLSASLTSINAALLHHLTPSPSAATVSDLKSGAALPQTTNPYGVKARDFHFQSRPSEFRASM
ASSAGFAAQDYAPSYDGGDSEESVGSSGDGGDGLAISDLGISPEIVKALSGRGIDKLFPIQKAVLEPAMQGRDMIGRART
GTGKTLAFGIPVIDKIIKFNAKHGRGKNPLCLVLAPTRELARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVA
VGTPGRIIDLMKRGALNLSEVQFIVLDEADQMLQVGFAEDVEVILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTID
LVGDSDQKLADGITMYSISADSYGKASIIGPLVEAHGKGGKCIVFTQTKRDADRLSYGLAKTFKCEALHGDISQSQRERT
LAGFRDGNFNILVATDVAARGLDVPNVDLVIHYELPNNTETFVHRTGRTGRAGKKGNAILIHGPEQSRAVKMIEREVGSK
FTELPSIPVERGSGSMFEGIGGRSGGSYGGGMRDRSSSYGGRSGGYGGGGGSGRYGGDRSEGSGNRYSGGSDRSSGYGGF
GSGGSNRSSGGYGGFGSDRSSQSSGRSSFGGFGLKDPNSSY*

DNA
ATGATCAGCACAGTTCTCCGCCGATCCGTCCTTGGTGCCTCAAGGCGGACTCAGACTCTCTCCGCCTCTCTCACCTCCAT
CAACGCCGCTCTACTTCACCACCTTACTCCATCCCCCTCCGCCGCCACAGTCTCCGATCTCAAATCTGGCGCCGCTCTCC
CTCAGACTACGAACCCGTATGGCGTTAAAGCGAGAGACTTTCATTTCCAATCCCGACCGTCGGAGTTCAGAGCGTCCATG
GCTTCTTCCGCTGGATTCGCGGCTCAAGATTACGCCCCTTCGTATGACGGAGGAGATTCGGAGGAGAGTGTTGGCAGCAG
CGGTGACGGCGGTGATGGGTTAGCGATATCTGACCTTGGGATCTCTCCGGAGATCGTCAAAGCTTTGAGTGGTAGAGGAA
TCGATAAACTCTTCCCTATTCAGAAAGCTGTGCTTGAGCCAGCGATGCAAGGTCGGGACATGATCGGTCGTGCTAGGACA
GGAACAGGAAAGACCCTTGCTTTCGGGATTCCCGTCATCGACAAAATCATCAAGTTCAACGCTAAACACGGGCGTGGGAA
GAACCCTCTTTGTTTGGTTCTGGCTCCGACAAGAGAGCTTGCTCGTCAGGTTGAGAAGGAGTTCAGGGAGTCTGCTCCAA
GCTTGGATACCATCTGTCTGTACGGGGGTACACCCATTGGACAGCAGATGAGGGAGCTCAACTACGGTGTCGATGTAGCC
GTTGGAACTCCGGGTCGTATCATCGATCTAATGAAAAGGGGAGCTTTGAATCTCTCAGAGGTTCAGTTTATTGTTCTCGA
TGAAGCTGATCAGATGCTTCAGGTTGGATTCGCGGAGGATGTTGAAGTTATATTGCAAAAGTTGCCTGAGAAGCGTCAGA
GCATGATGTTTTCTGCTACAATGCCGAGTTGGATCAGATCTCTCACCAAAAAGTACCTGAATAATCCTTTGACAATTGAT
CTTGTTGGAGATTCTGATCAGAAACTTGCAGATGGGATTACAATGTACTCTATCTCAGCAGATTCTTATGGAAAAGCATC
CATCATTGGTCCTCTTGTAGAGGCGCATGGTAAAGGAGGAAAATGCATCGTGTTTACACAAACTAAACGTGATGCTGATC
GCCTTTCGTATGGATTGGCGAAAACCTTCAAATGTGAAGCTTTACACGGTGACATATCGCAGAGCCAGAGAGAAAGAACA
CTAGCTGGTTTCAGAGATGGGAATTTCAATATCCTTGTTGCAACTGATGTTGCTGCTCGTGGACTCGATGTCCCTAATGT
CGACTTGGTAATTCATTACGAGCTTCCTAATAACACGGAGACGTTTGTTCACCGAACGGGGAGAACAGGTCGTGCTGGAA
AGAAAGGAAATGCGATTCTTATTCATGGTCCAGAGCAATCAAGGGCAGTTAAAATGATTGAGAGAGAAGTGGGAAGCAAA
TTCACTGAGCTTCCTAGCATTCCTGTGGAGCGTGGAAGCGGAAGCATGTTTGAAGGAATAGGTGGTCGATCTGGTGGATC
CTATGGAGGAGGTATGAGGGATCGCAGTTCAAGCTATGGTGGTCGTTCAGGTGGTTATGGTGGTGGTGGTGGTAGTGGTA
GATATGGTGGTGATCGTTCAGAAGGATCAGGCAACCGTTATTCTGGTGGTTCAGATCGTTCCTCTGGTTACGGGGGCTTT
GGTTCAGGAGGTTCAAACCGTTCATCAGGAGGTTATGGGGGATTTGGTTCAGACCGTTCTTCACAGTCAAGTGGAAGGAG
CAGCTTTGGTGGGTTTGGATTAAAGGATCCTAACAGCTCTTACTGA