Details for Kale Locus Bo5g098070

Position : C5 ( 5`- 31335874 .. 31341615 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098070

Protein [Map View]
MGSKCREIEERKREKEAEAIREMDRNREARRVPMAAAGNGLSRRRHRAGSFRDSPEEDVPVELPEAARLRDRGGSTKKER
ERERDRDRERERERDRLHSRSKRRRGERLVMVHGDDGGDDSSEESVNDDEEYDDGVGPPSSLKMHPPSSNISAASFPSSL
SNHHHHSHNHQRKNFPPTSKVFRSPPSPAPGTPVVSSWKAADEMIGVAVPRKARSACTKRPHESWASSASGGGVFASGEQ
IHRQVSPASNLASPSPPAPTSPSSSNVSARKKMPSGTKQKPLPPKSAPCKLSSSSSPVAVQDEIEIEIAEVLYGMMRMPL
AASKQESAGEEGAKTAVDVKSRVSSPISNSQAVLQSSTITLAANSSSSAIVPKRKKPRIIKYDDENSSSLPSRAVKSEAE
APSKSHVPLGDQLKRSGSADENSAVLDSTNPPPRESNASLDSRSSAEKKEINPPKEETVSPKVETSPGFRSDGDGAKISS
PAKEKKFEIDLMAPPPVRSTSERGGEMECVAAEANPKVTEVVTEAKPLLKEDGGNATIESEEKKRSRAVAEAEPHKSERS
CELKLDLEKSDNVGVVNKHHVQKQAPPQQQLSIPDKTAQATPMPLHMSMPGWPGGLPTMGYMPPTQGVVPADTTSSLSSA
AMQPPPHLLFNQPRPKRCATHCYIARNIQSHQQFIKMNPFWPAAAGSAPLYGTKACNISLMPPTELQGTVLGRSSNPGPD
VNSQSTSKGSDTGQRNQILLQQALPPGAANNMMHGPTFIIPVGQQPHAAAASVRPNSGNTVSSGATATANSMNGSASATP
AGAPTMTFSYPGMPGNETQYLAILQNNGYPFTVPAHVGAPPAYRGAPGQPMPFFNGSFYSSQMIQPPFSQPQKQQQQPQQ
QQSGQMPQSHSPSNQNGSVSTSSSAAQKHLQNQQLRPPINHGNSQGFPTHKVQSQPLSFQQRHQHRENTPQHSETVGEDS
PSTADSRSARSSVAYGQNYGMQMQPTHLGLMSSAAPGGGVVVSSSKHGEKKSQQQGSKAGMESFQSQGYAMTFATFNGAS
SAPSLNMSSIPQNHPMFHSMPEAARQGYQMMAANVAAAQAAQQKMNYSAPSDDGKSGSNATANTMEEQRKTGKTSGLNGG
QSIAFSNKHDLADASVSAVPSGSIVDTSRLLNLGSAMPQSSSSMPTSHQQQLMQQQQQLMQQQQQQHMQRNQSQQPYPTM
YLQKQQRYATSVAASAARTKGSVASNGSGFPDHSITVSPAGGAKFPQNLVQSPSNQVQSTQWKNNSPRTTNTAQPQSPSI
LSPSSAAAAASSLRNVSHKQQSRPQQSQISFAANSKPMASGSPMQQMQGGANNRAPSPPMLVGSPSTSSVSKNAGGSPRT
TASASSAANKAGQASSTTHSSSQPSKNLQSASVASSTGGRNNGPSVLGNPTTSSGSKSQQQQLSKHGLQQQAQLFFSNPY
MQSQHQQQQQITISPSGGYFIQRHQQQPGSTAAAGATPVTLSGCTTGAVTATSDPAKAIAAAAAAANNVKGGGGMGKTQQ
HQLGPPGFTYVHAVPSAVQVKPADQKQQAGE*

DNA
ATGGGAAGCAAGTGTAGAGAGATAGAAGAAAGAAAGAGAGAGAAGGAAGCGGAAGCAATTAGAGAGATGGATAGAAATAG
GGAAGCTAGACGAGTACCCATGGCGGCTGCCGGAAATGGCCTGTCACGGCGGAGGCATAGAGCCGGAAGCTTCAGAGATT
CTCCAGAGGAGGATGTACCAGTGGAGTTACCGGAGGCGGCGAGGCTGAGAGATCGAGGAGGGAGTACGAAGAAGGAACGA
GAACGGGAACGTGACAGAGACCGTGAGAGGGAAAGAGAACGGGATCGGCTACATAGCCGGAGCAAAAGACGGAGAGGAGA
ACGGTTAGTGATGGTTCACGGCGACGACGGCGGTGACGACAGCTCGGAAGAGAGTGTCAACGACGATGAAGAATATGACG
ACGGCGTCGGACCACCGTCCTCGTTAAAGATGCATCCTCCTTCTAGTAACATCTCCGCCGCTTCTTTTCCATCGTCTCTT
TCAAATCACCACCACCACAGCCACAACCACCAGAGAAAAAACTTTCCGCCAACGTCGAAAGTCTTCAGATCGCCTCCTTC
TCCGGCGCCAGGGACACCTGTCGTCTCGTCGTGGAAGGCTGCCGATGAGATGATCGGCGTAGCCGTTCCTAGAAAAGCTC
GGTCAGCTTGTACAAAGAGACCGCATGAATCATGGGCATCAAGTGCTAGCGGCGGTGGTGTTTTTGCCTCCGGAGAGCAA
ATCCACCGCCAAGTGTCTCCGGCTTCTAATTTAGCGTCTCCCTCTCCTCCCGCTCCTACATCACCTTCTTCATCTAACGT
TTCTGCACGGAAAAAGATGCCGTCGGGGACAAAACAAAAGCCTCTACCGCCGAAGTCAGCGCCGTGCAAGCTATCATCAT
CATCATCTCCGGTGGCTGTTCAAGACGAGATCGAGATAGAGATTGCAGAGGTGCTGTACGGAATGATGCGCATGCCTCTA
GCGGCGTCGAAACAAGAATCGGCCGGTGAGGAAGGTGCGAAAACAGCCGTGGACGTCAAATCCAGAGTATCTTCACCCAT
CTCTAATTCACAAGCTGTTCTTCAGTCTTCCACCATCACATTAGCTGCAAATTCAAGCTCATCAGCCATTGTCCCTAAAA
GAAAGAAGCCGAGGATTATCAAATACGACGACGAGAACAGTTCTAGTTTACCGTCACGCGCCGTTAAATCCGAAGCTGAA
GCTCCGTCTAAAAGTCATGTTCCGTTAGGCGATCAGCTAAAGAGATCGGGATCAGCCGACGAAAACAGCGCGGTGTTGGA
TTCGACCAATCCTCCGCCCAGAGAAAGCAACGCGTCGTTAGATTCGAGATCATCAGCGGAGAAGAAAGAAATTAATCCGC
CGAAAGAGGAAACAGTATCGCCTAAAGTGGAAACTTCCCCAGGATTTAGATCCGATGGTGATGGGGCTAAAATAAGTTCG
CCGGCGAAAGAGAAGAAGTTTGAGATAGATCTGATGGCGCCACCTCCGGTTAGATCGACATCGGAGAGAGGCGGTGAGAT
GGAATGTGTGGCAGCAGAAGCTAACCCTAAAGTCACGGAAGTGGTAACGGAAGCAAAGCCTCTGTTAAAAGAGGATGGAG
GTAATGCGACGATTGAGTCTGAGGAGAAGAAGAGATCTCGAGCGGTGGCTGAAGCTGAACCTCATAAGTCAGAGAGGAGT
TGTGAGCTCAAACTCGACTTGGAGAAATCTGATAATGTGGGTGTAGTAAACAAGCATCATGTTCAGAAACAGGCACCTCC
GCAACAACAACTATCTATTCCAGATAAAACAGCTCAAGCTACCCCTATGCCTCTGCATATGTCAATGCCTGGCTGGCCTG
GAGGTCTTCCTACAATGGGGTACATGCCACCTACACAAGGTGTTGTGCCTGCGGATACTACTAGCTCCTTATCCTCAGCA
GCAATGCAGCCTCCTCCACATTTACTTTTTAATCAACCGAGGCCTAAGAGATGTGCAACACACTGCTACATTGCTCGTAA
TATTCAATCCCATCAGCAGTTCATAAAGATGAATCCGTTCTGGCCTGCGGCAGCAGGCTCAGCTCCATTGTACGGGACCA
AGGCCTGCAATATCAGTCTCATGCCTCCCACAGAACTGCAGGGGACTGTTTTGGGAAGAAGTTCCAATCCTGGTCCAGAT
GTCAACTCTCAATCTACTTCCAAAGGCTCAGATACAGGTCAGAGAAATCAAATATTACTCCAACAAGCTCTGCCTCCAGG
AGCAGCTAATAACATGATGCATGGTCCTACATTCATTATCCCCGTGGGCCAACAGCCTCATGCAGCTGCCGCATCTGTCA
GACCTAATAGTGGCAACACAGTTTCTTCTGGTGCGACAGCTACTGCAAACTCCATGAATGGCTCTGCATCAGCTACTCCA
GCTGGTGCCCCAACAATGACCTTCAGTTATCCAGGCATGCCAGGCAATGAAACGCAGTACCTGGCCATTTTGCAGAATAA
TGGCTACCCGTTTACAGTCCCAGCACATGTCGGTGCACCACCTGCTTATAGAGGAGCTCCTGGACAGCCGATGCCATTTT
TTAATGGTTCGTTCTACTCCTCCCAAATGATCCAGCCTCCGTTTTCTCAGCCACAGAAGCAGCAACAGCAACCGCAGCAG
CAGCAATCTGGTCAAATGCCCCAGAGCCATTCTCCAAGCAACCAGAATGGAAGTGTTTCCACTAGTTCCTCCGCAGCTCA
AAAGCATCTGCAGAACCAACAGCTGAGACCGCCGATCAATCATGGGAACTCCCAAGGATTTCCAACTCACAAAGTCCAGT
CTCAGCCTTTGAGTTTTCAGCAGAGGCATCAACATAGAGAAAATACGCCTCAACATAGCGAGACTGTAGGAGAAGATAGC
CCATCAACTGCTGATAGCCGGTCTGCTCGTTCGAGTGTTGCCTATGGCCAGAACTATGGTATGCAGATGCAACCAACACA
CTTGGGTTTGATGAGTTCAGCAGCCCCAGGAGGGGGAGTGGTCGTATCCTCGAGCAAACATGGTGAAAAGAAATCACAGC
AGCAGGGTTCAAAGGCTGGTATGGAATCGTTTCAGTCGCAGGGTTATGCTATGACCTTTGCGACATTCAATGGGGCTAGT
AGTGCTCCTTCCCTGAACATGTCATCAATTCCTCAGAATCACCCTATGTTCCACAGCATGCCAGAAGCAGCAAGGCAAGG
TTACCAAATGATGGCAGCGAATGTTGCCGCAGCTCAAGCAGCCCAACAGAAAATGAACTACAGTGCTCCTTCAGATGATG
GAAAATCTGGGTCTAATGCTACTGCTAATACGATGGAAGAACAAAGGAAGACAGGGAAAACGAGTGGTTTGAATGGTGGG
CAGTCTATTGCTTTCTCTAACAAACACGACCTGGCTGATGCATCCGTTTCTGCTGTACCGAGTGGTAGCATCGTTGATAC
ATCCCGTTTGCTAAACCTTGGTTCTGCTATGCCACAGAGTTCCAGTTCTATGCCGACTTCTCATCAGCAGCAACTAATGC
AGCAGCAGCAGCAGCTTATGCAACAACAGCAGCAGCAGCATATGCAACGGAATCAATCGCAGCAACCTTATCCCACCATG
TATCTCCAGAAGCAGCAACGGTATGCAACATCAGTGGCTGCATCTGCTGCTAGAACCAAAGGGTCGGTGGCGAGTAATGG
GAGTGGTTTTCCTGATCACAGTATCACCGTATCGCCCGCGGGAGGTGCCAAGTTTCCTCAGAACCTTGTTCAGTCACCTA
GTAATCAGGTGCAGTCAACTCAGTGGAAAAACAATTCACCAAGGACAACAAACACTGCCCAACCTCAGTCTCCTTCCATA
CTGTCCCCATCATCTGCTGCTGCTGCTGCATCGTCCCTAAGAAACGTCTCGCATAAACAGCAAAGCCGTCCCCAGCAATC
GCAGATATCTTTTGCAGCAAACTCGAAACCAATGGCTTCTGGTTCACCTATGCAGCAGATGCAAGGAGGTGCCAACAACC
GAGCTCCATCTCCACCAATGTTAGTTGGATCACCTTCTACATCTTCGGTCTCCAAAAACGCCGGCGGAAGCCCAAGGACA
ACTGCTTCCGCTTCCTCAGCAGCGAACAAAGCTGGACAAGCTTCCTCCACTACTCACTCATCATCTCAGCCGTCCAAGAA
CTTACAGTCTGCATCTGTGGCGTCATCTACTGGGGGAAGGAATAATGGTCCTTCTGTTCTCGGAAACCCCACTACGAGCT
CTGGATCCAAGTCCCAACAGCAACAGTTGTCAAAGCATGGGTTGCAGCAGCAAGCCCAGCTCTTCTTTTCTAATCCTTAT
ATGCAATCTCAACATCAACAGCAGCAGCAGATCACAATCTCTCCTTCAGGTGGTTATTTCATTCAAAGACATCAGCAGCA
GCCAGGTTCCACAGCTGCTGCTGGCGCCACTCCTGTCACCCTCTCCGGCTGCACTACAGGAGCCGTAACTGCCACTTCAG
ATCCAGCGAAAGCCATCGCAGCCGCAGCAGCAGCAGCGAATAACGTGAAAGGAGGAGGTGGAATGGGGAAGACGCAGCAA
CATCAGTTGGGCCCTCCAGGGTTCACGTATGTACACGCGGTTCCCTCTGCGGTTCAGGTTAAACCCGCAGATCAGAAGCA
ACAAGCGGGTGAGTGA