Details for Kale Locus Bo5g098060

Position : C5 ( 5`- 31304304 .. 31309052 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098060

Protein [Map View]
CYIYTLINICVRDEKEHSIITHLSLHSPSIEFISLSPFSSFSLRENSAIYNAMIHTDIAEILCVKPKTKKRTKTMEEDVK
KKKTKKTMKIQGEVVVMKKNLLDFKDAMASFLDRVHELLGRRVSLQLVSSLQPDPANEKRGRLGKAAHLEKWVTKIKTSV
TAEETAFAVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRNFPGGEGGPIHFVCNSWIYPSHRYRSDRVFFSNKAYLPN
ETPELLKELRKEELKNLRDNEKGGELKEWDRVYDYAYYNDLGAPDKGPDSARPVLGGSPDFPYPRRGKTGRKPTKSDPKS
ESRLALLNLNIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASVCDKTINEFDSFEDVFHLYDGSIKLANGHTISKLR
DVIPWEMFRELVRNDGERFLKFPLPDVLKESRSAWRTDEEFAREMLAGLNPVVISRLQEFPPKSNLDSTRYGNQHSSIRE
EHIKPHMNGLSVQEALGQNKLYILDHHDALMPYLTRINSTNTKTYATRTLLLLQEDGTLKPLAIELSLPHAQGESHGAVS
KIFTPAEKGVEGSVWQLAKAYAAVNDSGYHQLISHWLKTHAVIEPFIIASNRQLSVIHPIFKLLHPHFRDTMNINALARH
VLINSDGVLERTVFPGRYAMEMSSSIYKNWVFTDQALPKDLLKRGVAVENPSSDNGIELLIEDYPFAVDGLEIWSAIKTW
VREYCTIYYKNDKAVQNDTEIQEWWNELRTKGHGDLQQESWWPSMQTCDDLIEACTIIIWVASALHAAVNFGQYPYAGFL
PNRPTVSRRFMPEPGTEEYTELEENEEVAFLKTITPQLQTLLGISIIEILSMHSTDEIYLGQRDSPNWTADEEPLEAFKR
FGKSLELIENNIIRRNNDKKFKNRTGPVNIPYTLLYPDTTDYTREGGLTGKGIPNSVSI*

DNA
TGTTATATATATACTCTTATAAATATATGCGTAAGAGATGAAAAAGAACATTCTATAATCACACATCTCTCTCTTCATTC
TCCAAGCATAGAATTTATCTCTCTCTCTCCCTTTTCTTCATTCTCACTCAGAGAAAATTCTGCAATATATAACGCCATGA
TCCACACCGACATCGCAGAGATCTTATGCGTGAAGCCCAAGACGAAAAAAAGGACAAAGACGATGGAGGAAGACGTCAAG
AAGAAGAAGACCAAGAAGACGATGAAGATACAAGGAGAAGTTGTTGTCATGAAGAAGAACCTTCTCGACTTCAAAGACGC
CATGGCTTCTTTTCTCGATCGAGTTCATGAGCTTCTTGGTCGTCGCGTATCTCTCCAGCTCGTCAGCTCTCTCCAACCCG
ACCCTGCCAATGAGAAGAGAGGAAGACTTGGAAAAGCAGCACATCTGGAAAAATGGGTGACAAAAATAAAAACGTCTGTA
ACCGCGGAGGAAACTGCGTTTGCGGTGACGTTTGATTGGGACGAGTCAATGGGACCACCGGCTGCGTTTGTGATCAAGAA
CCACCACCATAGCCAATTCTACCTTAAATCCCTCACTCTCCGCAATTTCCCTGGCGGTGAAGGTGGTCCGATACACTTCG
TTTGCAATTCTTGGATCTATCCAAGCCATCGGTACCGCTCTGACCGCGTTTTCTTCTCTAACAAGGCATATCTTCCAAAT
GAAACACCAGAGCTACTCAAAGAGCTAAGAAAGGAAGAGCTAAAGAATCTAAGAGACAACGAGAAAGGAGGAGAACTCAA
AGAATGGGACAGAGTTTACGACTACGCTTATTACAACGACTTAGGTGCACCCGACAAAGGTCCTGACTCAGCCCGTCCGG
TTCTCGGCGGTTCACCTGACTTTCCTTATCCTCGCCGCGGCAAAACCGGTCGTAAACCCACCAAATCCGACCCTAAGTCT
GAGAGCAGGTTGGCATTACTAAACCTGAACATCTACGTGCCGAGGGACGAGCGGTTTAGCCATGTGAAGTTCTCTGATTT
CCTCGCGTACGCACTCAAATCGGTGACTCAAGTGCTCGTCCCTGAAATAGCCTCAGTTTGCGACAAGACCATCAACGAGT
TTGACTCGTTCGAAGACGTTTTCCACCTCTATGACGGTAGTATTAAACTCGCCAATGGTCACACCATATCTAAGCTACGT
GATGTTATCCCATGGGAGATGTTTCGTGAGCTTGTTCGCAATGATGGTGAACGGTTCTTGAAGTTTCCTTTGCCTGACGT
CCTGAAAGAAAGTAGATCGGCTTGGAGGACTGATGAAGAGTTTGCGAGAGAAATGTTGGCTGGACTCAATCCAGTGGTTA
TAAGTCGTCTCCAGGAGTTTCCTCCAAAGAGCAATTTAGACTCTACAAGGTATGGAAACCAACACAGTTCCATACGAGAA
GAGCACATAAAACCACACATGAACGGTCTCAGTGTCCAAGAAGCTTTGGGACAGAACAAGCTATACATATTAGATCATCA
TGATGCATTGATGCCATACTTGACACGGATAAACTCGACAAACACTAAAACTTATGCGACCCGAACGCTTCTGTTGCTTC
AAGAGGACGGAACACTGAAGCCTCTAGCCATAGAGCTGAGTCTTCCTCACGCACAAGGTGAATCACACGGAGCGGTGAGC
AAGATTTTCACACCAGCAGAGAAAGGCGTGGAGGGATCGGTTTGGCAGCTTGCTAAGGCTTACGCCGCGGTTAATGATTC
CGGTTATCACCAGCTTATAAGCCACTGGTTGAAGACGCATGCAGTGATTGAACCGTTCATAATCGCGTCGAATAGGCAAC
TAAGTGTGATCCATCCGATCTTCAAACTTCTTCATCCTCATTTCCGTGACACGATGAACATCAACGCATTGGCACGACAT
GTCCTTATAAACTCTGATGGAGTTTTGGAGAGAACGGTGTTCCCTGGTCGTTACGCAATGGAAATGTCTTCTTCAATTTA
CAAGAATTGGGTTTTCACTGATCAGGCTCTTCCCAAAGATCTCCTCAAGCGTGGAGTTGCCGTTGAAAATCCAAGCAGTG
ATAACGGGATTGAGCTTCTGATTGAGGACTACCCGTTTGCAGTCGATGGTTTAGAGATATGGTCAGCGATTAAGACGTGG
GTGAGAGAGTACTGCACAATTTACTACAAGAATGACAAAGCTGTGCAAAACGATACCGAGATCCAAGAATGGTGGAACGA
GCTTCGAACCAAAGGTCACGGCGATTTACAACAAGAGTCATGGTGGCCGTCGATGCAAACCTGCGACGACCTCATCGAAG
CCTGCACCATCATCATCTGGGTCGCCTCTGCTCTCCACGCAGCAGTTAACTTCGGGCAATACCCTTACGCTGGCTTTCTC
CCAAACCGGCCTACCGTCAGCCGTCGGTTCATGCCGGAACCGGGTACGGAAGAGTACACAGAACTGGAGGAAAACGAGGA
GGTGGCGTTTTTAAAGACGATCACGCCGCAGTTACAAACTCTGCTTGGTATCTCCATCATAGAGATTTTGTCTATGCATT
CAACGGACGAGATTTACTTAGGGCAGAGAGACTCACCGAACTGGACGGCAGATGAGGAGCCTTTAGAGGCGTTCAAGCGG
TTTGGAAAGAGTTTGGAATTGATAGAGAACAATATTATACGAAGAAACAATGATAAGAAGTTCAAGAACCGGACCGGTCC
GGTTAACATACCATACACTCTCTTGTACCCGGATACTACGGACTACACGAGAGAGGGTGGACTTACTGGTAAAGGGATTC
CAAACAGTGTTTCTATTTAG