Details for Kale Locus Bo5g098030

Position : C5 ( 5`- 31286700 .. 31289171 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g098030

Protein [Map View]
MGKRDEKAEAVLRLLRKQTPLTLKQEKFCNRECVERFLKGKGDNVKKAAKQLTSCLSWRQNFDIERMGAEEFSAELADGV
AYIAGHDGESRPVIMFRFKHDYQKLRSQKQFTRLVAFTMETAISSMSRNAEQSVVLLFDASFFRSSSAFANLLLATLKII
ADNYPCRLYKAFIIDPPSFFSYIWKGVRPFVELSTVTMLISSLDYDEQLDISHVSSSSCLRSASLRFDPSSIKSTAKIGS
ASSRFAFTVTRNSMKPWYLSLTDTSPFHAAVDSTASKVSPLSVRSLSFASPAGRGLRDPKPAACRKSLFPSTPLPEKTKT
VPHRKTPRPSFFQSPAMFFRGEKNVGGGEKSSREAFVPYLKFYRRPYDETAYRSKLRGPRGFVSVVSSHRRCRHVSLSQR
F*

DNA
ATGGGCAAGAGAGATGAGAAAGCCGAAGCTGTTCTTCGTTTACTCAGGAAACAAACTCCACTCACTCTTAAACAAGAGAA
GTTCTGTAACAGAGAATGCGTGGAGAGATTCTTGAAAGGGAAAGGAGACAACGTCAAAAAAGCTGCGAAGCAGCTAACTT
CATGCCTTTCGTGGAGACAAAACTTTGATATTGAGCGAATGGGGGCAGAGGAGTTCTCGGCGGAGCTAGCCGACGGCGTA
GCTTACATCGCCGGCCACGACGGAGAATCCAGACCCGTTATCATGTTCCGTTTCAAGCATGATTATCAGAAGCTGCGTAG
CCAGAAACAATTTACGCGTTTAGTGGCGTTCACGATGGAGACTGCGATCTCGAGCATGTCCAGAAACGCGGAACAGAGCG
TTGTTCTACTCTTCGATGCAAGCTTTTTCAGATCATCCTCTGCTTTTGCAAATCTGCTTTTGGCAACCCTAAAAATTATC
GCAGATAATTACCCATGCCGACTTTACAAGGCCTTTATCATCGACCCTCCCTCCTTTTTCTCTTACATTTGGAAGGGTGT
ACGTCCTTTCGTGGAGCTATCTACTGTCACTATGTTAATCTCGTCTCTAGACTACGACGAGCAGCTAGATATTAGCCACG
TGTCATCATCCTCATGTCTTAGATCAGCTTCCCTACGTTTCGATCCATCGTCGATCAAATCAACGGCTAAGATTGGTTCA
GCTTCTTCAAGATTCGCCTTCACCGTAACTCGCAACTCAATGAAGCCGTGGTACCTTTCCTTAACCGACACATCACCGTT
TCACGCCGCCGTCGACTCCACCGCTTCCAAAGTATCTCCTCTCAGCGTGCGTTCTCTATCTTTCGCGTCTCCGGCGGGGC
GTGGCTTAAGAGACCCGAAACCAGCCGCATGCAGAAAGAGTTTGTTTCCCTCGACGCCGTTGCCGGAGAAGACGAAAACG
GTTCCGCACCGGAAAACTCCACGTCCGTCTTTTTTTCAGTCCCCGGCAATGTTCTTTCGCGGGGAGAAAAATGTCGGCGG
AGGCGAGAAGTCATCACGTGAAGCGTTCGTACCGTATCTGAAGTTTTATCGGAGACCGTACGATGAGACGGCCTATAGGT
CTAAACTGCGGGGTCCACGTGGATTTGTGTCAGTCGTGTCTTCGCACAGAAGATGTCGCCACGTATCTTTATCTCAACGG
TTCTAG