Details for Kale Locus Bo5g097020

Position : C5 ( 5`- 31234479 .. 31236124 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g097020

Protein [Map View]
MGAEVSSFEGFEQERHTKLSLSLCGSFRCMSSASAMFSQSSAQLVRPNLGFMVSPSQKASIASSSLPRFLRMESQSQSQP
RQSISCASSPSSNLSQANSSSLIESARIGEVKRVTKETNVSVKINLDGTGVADSSTGIPFLDHMLDQLASHGLFDVHVRA
TGDVHIDDHHTNEDIALAIGTALLKALGERKGINRFGDFTAPLDEALIHVSLDLSGRPYLGFNVKIPTQRVGNYDTQLVE
HFFQSLVNTSGMTLHIRQLAGENSHHIIEATFKAFARALRQATENDPRRGGTIPSSKGVLSRS*

DNA
ATGGGAGCTGAAGTGTCGTCGTTTGAGGGATTCGAACAAGAAAGGCATACAAAGCTCTCTCTCTCTCTCTGTGGTTCCTT
CCGCTGTATGTCGTCTGCGTCCGCCATGTTTAGTCAATCTTCCGCTCAGCTTGTGCGACCTAACCTCGGATTTATGGTTT
CGCCCTCTCAGAAGGCGTCGATCGCTTCTTCTTCGCTTCCTCGATTTTTGCGGATGGAGTCTCAATCTCAGTCTCAGCCT
CGCCAATCTATTTCCTGCGCTTCTTCACCAAGCAGTAACCTTTCTCAGGCTAATTCTTCTTCCTTAATCGAATCAGCTCG
CATTGGAGAAGTTAAGAGAGTAACAAAGGAGACTAATGTGTCAGTGAAGATCAATTTGGATGGCACTGGAGTTGCAGATA
GCTCCACTGGAATCCCTTTCCTTGACCATATGTTAGATCAACTTGCTTCACATGGGTTATTTGATGTGCACGTAAGAGCT
ACTGGTGATGTTCATATCGATGATCATCACACTAACGAAGATATAGCTCTTGCCATTGGAACTGCTCTGTTGAAGGCGCT
TGGTGAGCGTAAAGGGATTAATCGGTTTGGTGACTTCACAGCTCCTCTTGATGAAGCACTTATACATGTTTCCCTGGACT
TGTCTGGTAGACCATATCTTGGTTTCAACGTGAAGATTCCAACCCAGAGAGTTGGAAACTATGACACTCAGTTGGTGGAG
CACTTTTTCCAGTCGTTGGTGAATACTTCCGGTATGACACTTCACATCCGTCAGCTTGCTGGTGAAAACTCTCATCACAT
AATAGAGGCCACCTTTAAGGCCTTTGCCAGGGCTCTAAGACAAGCAACGGAGAATGATCCTCGCCGTGGTGGGACCATTC
CCAGTTCAAAAGGAGTCTTGTCACGGTCTTGA