Details for Kale Locus Bo5g097010

Position : C5 ( 5`- 31228797 .. 31232498 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g097010

Protein [Map View]
MMVGGNNAKSTPQKPPTTSAAASSSHHRKSRWGSNNNDGGSSKTNTTTSNNKQTTGGQKIPDKKLPNPSPNLAPITSQSR
PNPTPSSSSRSALPPAQFAFPDPSAALGAPPAPTYGFHMLERRTIVLVDGSVRSYFALPPNYRDFPPKPRLPDPAANRFM
GPEFGRFPPEEFRDQRQHEGSMKRKHPGEEEIDGRDERGELLRQRQQFMLYANPNDPSLMAGTSRRDSGEDARAAKHMRV
GSSRNENGGQVALKKAFLDLVKRIYEDPSEKKNYLENGRKGRLQCLVCGRCPKDVQDTHGLVMHTYYCDDTSSRVHHLGL
HKALCVLMGWNFSKPPDNSKAYQNLPAEMVAINQDELILWPPHIIVHNTSTGKGKDGRMEGLGSKRMDDRIRELKFNVGK
SRALYGRDGHLGITLFKFAGDDSGLREALRIAEYFEKMNRGRKSWAGLQPFTPSKDDENNPSLMEVDGKTGEKKRVLYGY
LATVKDLDKVDMETKKKTTIESLRELAGSK*

DNA
ATGATGGTCGGGGGCAATAACGCCAAGTCAACGCCTCAAAAGCCTCCAACAACCTCCGCCGCAGCTTCTTCTTCCCATCA
CCGTAAATCTCGTTGGGGCTCAAACAACAACGATGGTGGTAGCAGTAAGACTAACACAACCACCAGCAACAACAAGCAGA
CGACGGGTGGCCAGAAAATCCCCGATAAGAAACTTCCGAATCCTTCTCCTAACCTAGCTCCGATCACGAGCCAATCCCGT
CCCAATCCAACACCCTCATCATCATCGCGTTCTGCTCTACCCCCGGCGCAATTCGCTTTCCCAGATCCGTCGGCGGCGCT
TGGTGCTCCTCCTGCGCCGACTTACGGGTTCCATATGCTCGAGCGTCGCACCATCGTCCTCGTCGACGGAAGCGTCCGAT
CATACTTCGCGCTTCCTCCTAATTACCGTGATTTCCCTCCCAAGCCCCGTCTCCCTGATCCGGCGGCTAATAGATTTATG
GGACCTGAATTCGGTAGATTCCCTCCGGAGGAGTTTAGAGATCAGAGGCAGCACGAAGGATCAATGAAACGGAAACATCC
AGGCGAGGAAGAGATTGATGGGAGGGACGAGAGAGGTGAATTGCTGAGACAAAGGCAGCAGTTTATGCTCTATGCGAATC
CTAATGATCCCTCGCTTATGGCTGGTACGAGTAGGAGGGATTCTGGGGAAGATGCTAGAGCGGCTAAGCACATGCGGGTG
GGATCAAGCAGGAATGAGAATGGAGGTCAGGTTGCGTTGAAGAAAGCGTTTTTGGATTTGGTTAAGCGGATTTACGAGGA
CCCGTCCGAGAAGAAGAACTACTTGGAGAACGGGAGGAAAGGGCGGCTTCAGTGTCTCGTCTGCGGCAGGTGTCCTAAAG
ACGTCCAGGATACACATGGTTTGGTAATGCACACGTACTATTGCGATGATACTAGCTCACGTGTGCATCACTTAGGCCTA
CACAAAGCTCTATGTGTATTGATGGGATGGAATTTCTCAAAGCCCCCTGATAACTCGAAGGCTTACCAGAATCTACCTGC
GGAAATGGTAGCAATCAATCAAGACGAGCTGATTCTATGGCCACCTCACATTATTGTTCACAATACGAGTACAGGGAAGG
GTAAAGATGGGCGTATGGAAGGTCTTGGAAGCAAAAGAATGGATGATAGAATTAGAGAACTAAAATTCAACGTTGGGAAA
TCAAGGGCACTGTATGGAAGAGACGGTCATCTAGGAATTACCCTCTTTAAATTTGCGGGAGATGATTCAGGGCTCAGGGA
AGCTTTGAGAATTGCCGAATACTTTGAGAAAATGAACCGTGGGCGCAAAAGTTGGGCCGGGTTACAACCATTCACTCCAA
GCAAAGATGATGAGAACAACCCTAGTCTTATGGAGGTTGATGGTAAGACAGGTGAGAAAAAGAGGGTCCTTTATGGTTAT
CTGGCGACCGTAAAAGACTTGGACAAAGTCGATATGGAGACAAAGAAGAAGACCACAATTGAGAGCCTAAGAGAACTCGC
AGGATCAAAGTAA