Details for Kale Locus Bo5g097000

Position : C5 ( 5`- 31224340 .. 31226376 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g097000

Protein [Map View]
MGLVPDPGELTELAQPSFDKFQKQASLMTSCSLMWKDLTDHFTTLEQNLMKKSEALKKMIETLDNQTQTSLESIDRSVEI
VAEKVGKRVRAALESLEKARDGGDDDDSEVDDDDEEGLLSALKSLCWKMDARGFWSFVTARKKEIENPRSKIPAALGDCV
DPEMLVLEAISEVFPVDKRESGEKMMNDFAWACVVILESLGPVMVDPVIGKSRLIVTPSVKEKAEEVAETWKASLEERGR
VEDVKTPDVHTFLQHLVMFGIFRSEDLGLYRKLVVGSAWRKQMPKLAVSVGLGDQMPDMIEELISRGHQLDAVHFTYEVG
LVDKFPPNLVARKEQSALKAVLKCIEEYKLKEEFPPENLKKRLDQLEKTKTDKRKPAAVPANKRTRASYNGPMPPAKVGR
ITNAYVSSFPFIRSPSHSPQYASPSAYPSPPVTVYSNRSPPYPYSPELIPGSYQGSPIGYPAYSGYCNGPVPVTAPAPPV
YHPHYHQQQHHQHAHHPQAYY*

DNA
ATGGGGTTGGTCCCCGATCCAGGCGAGTTAACCGAGCTAGCACAGCCGAGTTTTGACAAGTTTCAGAAGCAGGCGTCGTT
GATGACGAGCTGCAGTCTTATGTGGAAGGATCTCACCGATCACTTCACTACACTGGAGCAGAACCTGATGAAAAAATCAG
AGGCGCTGAAGAAGATGATTGAAACCCTAGACAACCAGACTCAGACCTCTCTCGAGTCAATCGACCGCAGCGTCGAGATC
GTCGCTGAGAAAGTTGGGAAACGCGTCAGAGCTGCTCTGGAGTCGCTTGAGAAAGCTAGAGACGGCGGCGATGACGACGA
CAGTGAGGTTGACGACGATGATGAGGAAGGGCTTCTCTCTGCATTGAAGTCTCTCTGTTGGAAGATGGACGCTAGAGGAT
TCTGGAGCTTCGTGACGGCGAGGAAGAAGGAGATTGAGAATCCCCGGTCAAAGATTCCGGCGGCGTTGGGGGACTGTGTG
GATCCGGAGATGTTGGTGCTCGAGGCGATCTCTGAGGTTTTCCCGGTGGATAAAAGGGAGTCTGGAGAAAAGATGATGAA
CGATTTCGCATGGGCTTGTGTGGTGATTCTGGAAAGTTTAGGGCCTGTGATGGTGGATCCGGTGATCGGGAAGTCGCGGT
TGATTGTTACTCCTAGCGTTAAGGAGAAGGCTGAGGAGGTGGCAGAGACGTGGAAGGCGAGTTTGGAGGAGAGAGGGAGG
GTGGAGGATGTGAAGACTCCTGATGTCCATACGTTTCTGCAGCATCTTGTGATGTTTGGGATTTTCAGAAGTGAAGATCT
TGGTCTCTACAGAAAGCTTGTTGTTGGTTCCGCATGGCGTAAACAGATGCCGAAGCTTGCTGTTTCGGTTGGTTTAGGTG
ATCAGATGCCAGATATGATCGAAGAGTTGATCAGCAGGGGACATCAACTTGATGCTGTTCATTTTACTTATGAAGTTGGT
CTTGTGGATAAGTTCCCTCCTAATCTTGTGGCGCGAAAGGAGCAATCAGCTCTCAAGGCGGTATTGAAGTGCATAGAAGA
GTACAAACTCAAAGAAGAGTTCCCTCCAGAGAACCTCAAGAAGCGTTTGGACCAGCTGGAGAAGACTAAAACCGACAAGA
GAAAACCAGCAGCTGTACCAGCAAACAAGAGAACCAGAGCCAGCTACAACGGTCCAATGCCACCAGCCAAAGTCGGTCGT
ATCACAAACGCATACGTCTCTTCCTTCCCCTTCATCAGATCACCCTCTCACTCACCTCAGTACGCTTCACCATCAGCTTA
CCCATCCCCACCTGTTACTGTCTACAGCAACAGAAGCCCACCTTATCCATACTCGCCTGAGCTTATCCCGGGCTCATACC
AAGGCTCACCTATCGGTTATCCAGCGTACAGCGGTTATTGCAACGGTCCGGTTCCTGTTACTGCCCCAGCTCCTCCGGTT
TACCACCCACACTACCATCAGCAGCAGCACCACCAACACGCTCACCATCCGCAAGCTTACTACTGA