Details for Kale Locus Bo5g096980

Position : C5 ( 5`- 31214085 .. 31214647 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g096980

Protein [Map View]
MMFDLGSTRHALDCAAVGTVLAQRSLEDDIHDVMYTPRKGDKVEGKLQVVLQAIIDTGVVVKVKLKQRKLKKKTSHIYNI
ALYVVCVPRQSPRHLGFDPRRRR*

DNA
ATGATGTTCGATCTTGGATCGACTAGGCACGCATTGGATTGTGCTGCGGTTGGGACAGTCCTTGCTCAGAGGAGTTTGGA
AGATGACATACACGACGTTATGTACACGCCTAGGAAAGGAGATAAAGTGGAGGGTAAGCTTCAGGTTGTGCTTCAAGCTA
TTATTGATACTGGTGTTGTTGTTAAAGTGAAGCTTAAGCAGAGGAAACTCAAGAAAAAGACTAGTCATATATATAACATC
GCCCTATACGTGGTCTGCGTACCACGTCAATCTCCCAGGCATCTCGGGTTCGACCCGCGCAGGAGGCGGTGA