Details for Kale Locus Bo5g096930

Position : C5 ( 5`- 31101545 .. 31101997 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g096930

Protein [Map View]
MASGGGGGLREPPNEQAVLNIYEAMRSELSQIYSNITDLEMQVSEHSLVINAIQPLDQSRKCFRMIGGVLVERTIREVLP
AVQRNKEGLEEVVRKLYETLEKKKKDMTEFEAKYQIRLRKQDDSNKEEGDKKKEGNAQGVLVGAAAASSS*

DNA
ATGGCGAGCGGTGGCGGCGGCGGCTTGAGAGAACCACCGAACGAGCAAGCAGTTCTGAACATCTACGAGGCAATGAGATC
AGAGCTGAGCCAGATCTATTCCAACATAACCGATCTCGAGATGCAAGTCAGCGAGCACTCTCTCGTCATCAACGCTATTC
AGCCTCTCGACCAGTCTAGGAAGTGCTTCCGCATGATAGGAGGCGTTCTTGTGGAGAGAACCATCAGAGAGGTGCTCCCT
GCTGTCCAGCGCAACAAGGAAGGCCTCGAGGAGGTTGTGAGGAAGCTTTACGAGACGTTGGAGAAGAAGAAGAAAGATAT
GACTGAGTTTGAAGCTAAGTATCAGATCAGGCTTAGGAAGCAGGACGATTCTAATAAGGAAGAAGGTGATAAGAAAAAGG
AAGGTAACGCTCAAGGTGTTCTTGTTGGCGCTGCTGCTGCCAGTTCGAGCTAG