Details for Kale Locus Bo5g096920

Position : C5 ( 5`- 31100286 .. 31101232 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g096920

Protein [Map View]
MSQQEQPRRPQEPVKYGDVFEVSGELADKTIAPEDANMMQAAETRVFGHTQKGGTAAVMQSAATANKRGGFVQQGDATDV
AAEHGVTVAQTDVPGARVTTEFVGGQVVGQHVEPMPVGTTAATDAETLGLNLQSAITIGEALEAAVQTAGNKPLDQSDAA
AIQAAEVRASGTSVIAPGGIAASAQSAANHNATVDRDEDKIKLVDVLAGATGKLQADKAVTRQDAEGVVSAELRNNPNLT
THPGGVAASVTAAARLNEKADI*

DNA
ATGAGCCAACAAGAGCAACCACGTAGGCCACAAGAGCCGGTGAAATACGGAGACGTTTTCGAGGTCTCCGGGGAGCTAGC
TGATAAGACCATAGCGCCTGAGGATGCAAACATGATGCAAGCAGCCGAGACGCGCGTCTTCGGACACACTCAAAAAGGAG
GTACAGCCGCCGTCATGCAGTCTGCAGCCACTGCCAACAAACGTGGTGGCTTCGTCCAACAAGGTGACGCAACCGACGTC
GCGGCTGAACATGGCGTCACCGTGGCGCAAACAGACGTCCCTGGTGCACGTGTCACTACAGAATTCGTCGGTGGACAGGT
CGTTGGACAACACGTGGAGCCGATGCCTGTGGGGACTACTGCGGCTACAGATGCTGAAACGTTGGGATTGAATTTGCAAA
GTGCGATAACAATAGGAGAAGCATTGGAGGCAGCTGTACAAACCGCTGGAAACAAACCGCTGGACCAGAGCGATGCAGCA
GCGATCCAAGCGGCGGAGGTTAGAGCTTCTGGAACCAGCGTCATTGCTCCTGGTGGTATCGCCGCTTCAGCTCAATCCGC
AGCGAATCACAACGCTACTGTGGACCGTGACGAGGACAAAATCAAGCTCGTTGATGTTTTAGCGGGTGCTACGGGGAAGC
TACAGGCGGATAAAGCCGTGACGAGGCAGGATGCAGAGGGTGTGGTGAGCGCTGAGCTGAGGAACAACCCTAACTTGACT
ACTCATCCAGGTGGTGTGGCAGCTTCTGTTACAGCCGCGGCTAGGCTTAACGAGAAGGCGGATATATGA