Details for Kale Locus Bo5g096890

Position : C5 ( 5`- 31088370 .. 31090935 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g096890

Protein [Map View]
MSAPFYSTIDMHHQQIHGQTPPGFDTEPVPLSTYREAEPDPFHATQQEKDDFWSNGFNREEPESFQAKENGKRSVDHNSS
FTHGETDLNQLPAIAQFSTGQGLPYAPVDWPSPGDVWTWRVGRRVTATGFHQDRFLILPQRLQQKNVPKSFASKPTLARY
IQTNFPGMDADAFFASFSWKIPALFQPANKVDAASLFEETPKEVQTEATAPNDENAKEGNSRYSQRKRNPMPTYDHPVEE
PKPKATPRGSGNKKKKGATTPATGTQSSTKPKPSRQSGRRSSNQQNGGAVDLNNLNKEGEPNTSGRRKKRRANFEEEEDV
SIPHIYVSPMNGVLAVSHEPIDVDPSRRCCSTKPKPSRQSGRRSSNQQNGGAVDLNNLNKEGEPNTSGRRKKRRANFEEE
EDVSIPHIYVSPMNGVLAVSHEPIDVDPIEFDSYLNSLENLLHESQEDAARESSSVLVTASSPMRDYEWAEARMKISSLL
EKDLPTLFVSKDAAEIAALATKLRKDPNLSAEEIVRLKLIEEIPTFSEVFQENKSVIEEADWFFSALELNKAKVASLKYE
YSDLRHKLGSIQVEVDENSEAIRQIDDQIGQLQARRNELKRYVGSKEKEKVDLSYGQKMVANSIPKVVQEVQSANSKKHE
WECKKDNALKHEEEILSKFTPLKGFFL*

DNA
ATGTCTGCTCCGTTTTATTCTACGATTGATATGCATCATCAACAGATCCATGGTCAAACTCCTCCTGGGTTTGATACTGA
ACCTGTCCCACTCTCAACCTACCGAGAAGCCGAACCTGACCCATTCCACGCCACTCAGCAAGAGAAGGACGACTTCTGGA
GCAACGGTTTCAACAGAGAAGAGCCAGAGTCCTTTCAAGCCAAAGAAAATGGAAAGAGAAGCGTAGACCACAACAGCTCC
TTCACTCATGGGGAAACCGATCTCAACCAACTCCCAGCTATCGCACAGTTTTCAACTGGTCAAGGTCTGCCTTACGCCCC
TGTTGATTGGCCCAGCCCCGGTGATGTTTGGACTTGGAGAGTTGGTAGGAGAGTGACTGCTACTGGGTTTCATCAAGACA
GGTTCTTGATTCTCCCTCAGAGGCTTCAACAGAAGAATGTGCCAAAGTCTTTCGCAAGCAAACCCACTCTCGCTCGTTAC
ATCCAAACGAATTTCCCTGGAATGGATGCTGATGCTTTCTTTGCATCATTTAGCTGGAAGATCCCTGCTCTCTTCCAGCC
TGCCAACAAAGTTGATGCTGCGTCTCTTTTCGAGGAGACACCGAAGGAAGTACAGACTGAAGCTACTGCTCCAAATGATG
AGAATGCTAAAGAAGGAAACTCCAGGTACAGCCAGCGGAAGAGGAATCCAATGCCTACGTATGACCATCCTGTGGAAGAA
CCTAAACCTAAAGCAACTCCACGAGGTAGTGGCAACAAGAAGAAGAAAGGAGCCACAACTCCCGCCACTGGAACTCAATC
CTCCACCAAACCAAAACCATCTCGTCAATCCGGAAGACGCTCTTCAAACCAGCAGAACGGTGGCGCTGTGGACTTAAACA
ACCTCAACAAGGAAGGTGAACCAAACACTAGCGGCAGGAGAAAGAAACGCAGAGCTAACTTTGAGGAAGAAGAAGATGTT
TCTATCCCTCACATCTACGTCTCTCCTATGAACGGTGTCCTCGCTGTCTCACACGAGCCTATCGATGTTGACCCTTCAAG
AAGATGCTGCTCCACCAAACCAAAACCATCTCGTCAATCCGGAAGACGCTCTTCAAACCAGCAGAACGGTGGCGCTGTGG
ACTTAAACAACCTCAACAAGGAAGGTGAACCAAACACTAGCGGCAGGAGAAAGAAACGCAGAGCTAACTTTGAGGAAGAA
GAAGATGTTTCTATCCCTCACATCTACGTCTCTCCTATGAACGGTGTCCTCGCTGTCTCACACGAGCCTATCGATGTGGA
CCCTATAGAGTTCGACAGCTACCTAAACTCTCTTGAGAACCTTCTTCATGAGAGTCAAGAAGATGCTGCGAGAGAGTCTT
CCTCTGTTCTCGTCACTGCAAGCTCTCCAATGAGAGACTACGAATGGGCTGAAGCTAGAATGAAGATCTCCTCTCTCCTT
GAGAAAGACCTCCCCACTCTGTTCGTCTCCAAGGACGCTGCAGAGATAGCAGCGTTAGCAACTAAACTGAGGAAAGATCC
GAACCTCTCCGCCGAAGAGATAGTGAGGTTGAAGCTTATAGAAGAGATTCCAACGTTCAGTGAAGTCTTCCAGGAGAACA
AGAGTGTGATTGAAGAAGCAGACTGGTTCTTCTCTGCGCTTGAGCTCAACAAAGCTAAAGTAGCGTCGCTTAAATACGAG
TACAGCGATCTGAGGCACAAACTAGGGAGTATACAGGTGGAAGTAGATGAGAACTCTGAGGCGATTCGCCAGATTGATGA
CCAGATCGGTCAGCTTCAAGCTAGGCGGAATGAGCTGAAGAGGTACGTAGGGAGCAAGGAGAAGGAGAAGGTTGATCTTA
GCTATGGGCAGAAGATGGTGGCGAACTCGATACCTAAAGTGGTGCAGGAAGTTCAGTCAGCTAACTCGAAGAAGCATGAA
TGGGAATGTAAGAAGGATAATGCGCTTAAGCATGAAGAAGAGATCCTCTCTAAGTTCACTCCTCTTAAAGGCTTCTTCCT
CTGA