Details for Kale Locus Bo5g096880

Position : C5 ( 5`- 31086826 .. 31087416 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g096880

Protein [Map View]
MVLIPSNRSHFLFPSLILSLLIILTIEKPDPEAMRVHPIPRNLNKNNTLIHHHRRNPTREPGKNLRRLPHIFNRVLELPL
RSEANVSVEEKHDCFRFVAETEGLCDGGEMRAYVVDIHPGITKIVVRTNGLSLGLSLDELELDMWRFRLPETTRPELVTV
VCVGGVLIVTVPKMVPEEEDGGFGQGMGSGRLVLVQ*

DNA
ATGGTTTTGATTCCTTCGAATCGATCACACTTTCTATTCCCGAGTCTGATCCTATCGCTTCTCATCATTCTAACAATCGA
GAAACCCGACCCGGAAGCCATGAGAGTCCACCCAATCCCCAGAAACCTTAACAAAAACAACACCTTGATCCACCACCATC
GTCGTAACCCGACCCGAGAACCCGGAAAGAATCTGCGTCGTTTACCGCACATCTTCAACCGCGTTCTTGAGCTTCCGTTA
AGGTCCGAAGCAAATGTTTCCGTGGAGGAGAAACACGATTGTTTCAGATTCGTGGCGGAGACAGAGGGTCTCTGCGACGG
CGGAGAGATGAGGGCTTACGTGGTGGATATTCATCCCGGTATAACCAAGATCGTTGTGAGGACAAATGGGTTGTCTTTGG
GGTTGTCGTTGGACGAGTTGGAGCTCGACATGTGGCGTTTTAGGCTTCCGGAGACGACAAGGCCTGAACTTGTTACGGTG
GTTTGTGTTGGTGGGGTTTTGATTGTTACGGTGCCGAAGATGGTTCCAGAGGAGGAAGATGGTGGTTTTGGACAAGGTAT
GGGAAGTGGGAGGCTTGTTCTTGTTCAGTAA