Details for Kale Locus Bo5g095810

Position : C5 ( 5`- 30975947 .. 30976273 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g095810

Protein [Map View]
MEIESVRCECCGLMEECTRDYISEVKSNFDNKWLCGLCSEAVRDEVSRRKMTTVDEAVRAHVSFCGKFKDNPAVLVADGM
RQMLRRRSGDLTSSASKKFGRSNSTKLY*

DNA
ATGGAGATTGAATCTGTGAGATGTGAGTGTTGTGGATTGATGGAAGAGTGTACACGAGATTACATTAGTGAAGTCAAATC
CAACTTCGACAACAAATGGCTCTGTGGTCTTTGCTCAGAAGCCGTGAGAGACGAAGTCAGTCGCCGGAAGATGACTACTG
TTGATGAAGCTGTTAGGGCCCATGTGTCGTTTTGTGGGAAGTTTAAAGATAATCCGGCGGTTCTTGTAGCCGACGGTATG
AGGCAGATGCTAAGGAGGAGATCCGGCGACTTGACTTCCTCTGCTTCCAAGAAATTTGGCAGATCTAACTCCACCAAGTT
GTACTAA