Details for Kale Locus Bo5g094640

Position : C5 ( 5`- 30771417 .. 30771839 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g094640

Protein [Map View]
METPPSIFLRPFDLSDAEDVLKWAGDDDVTRYLRWTSVKTVEEARQHILQTAIPHPWRRSICLLKDGRSIGCVSVRPHTG
DGRCRADLGYAVSRQFWGRVIATAAVRMAVEQAFEIFPDVVRLQAVVEVENKESFGESWV*

DNA
ATGGAAACGCCACCAAGTATCTTCCTCCGTCCGTTTGATCTCTCAGACGCCGAAGACGTTCTTAAATGGGCCGGTGATGA
TGACGTCACACGTTACCTTCGATGGACCTCCGTTAAAACCGTGGAAGAAGCCCGACAACACATCCTTCAAACGGCCATAC
CACACCCGTGGCGCCGTTCCATTTGTCTTCTCAAAGACGGTCGTTCGATAGGTTGCGTCTCCGTCAGGCCTCATACTGGC
GATGGTAGGTGCCGAGCTGACCTTGGATACGCCGTCTCTAGACAGTTTTGGGGACGGGTGATAGCCACGGCGGCGGTGAG
GATGGCCGTGGAACAAGCTTTTGAGATTTTTCCGGACGTGGTGAGGCTACAAGCGGTTGTTGAGGTGGAGAATAAAGAAA
GTTTTGGAGAAAGCTGGGTTTGA