Details for Kale Locus Bo5g094630

Position : C5 ( 5`- 30764678 .. 30766100 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g094630

Protein [Map View]
MDPLSVLKDFTTRGDLDKIERVGANYRFGSGYSFPCATETAYRSKGGSLYTLEALVHYVKNHHLKLGEYMQSTVKNSVPA
VTLPDRKPLLDYLTGRVASSDSIDYLLLQQQNAQSQKQNEEYRPDQDNSAFVSRENAVEEVDGYGGEDVDYIMLIRSNER
PLKSRDAILECKNRDFHSVLVNSTKREEERQRIESHQRKDGLVAKSRLMGAEERGIVGFTGGGGDDSGYDANPKSKLRKI
GEGVPIILVPSAFQTLITIYNVKEFLEDGVYIPNDVKAKEMKGVKPDCITVQKKFSRDRERVVTAYEVRDKPSALKPDDW
DRVVAVFVLGKDWQFKDWPFKDHVEIFNKIIGFFLRFEDDSIESAKTVKQWNVKIISISKNKRHQDRAAALEVWEKLEEF
VRSRSHS*

DNA
ATGGATCCGTTATCGGTGCTGAAGGACTTCACGACGCGCGGAGACCTGGATAAAATCGAACGGGTCGGAGCCAATTACCG
ATTCGGATCCGGATACTCCTTCCCCTGCGCGACAGAGACGGCGTACAGATCCAAAGGCGGAAGCCTCTACACTCTAGAAG
CCTTAGTCCACTACGTGAAGAACCACCACCTCAAACTCGGAGAGTACATGCAATCCACCGTCAAAAACTCCGTCCCCGCC
GTTACGCTACCGGATCGGAAACCTCTCCTCGATTACCTCACCGGGAGAGTAGCCTCCTCCGATTCGATCGACTACCTCCT
GCTCCAGCAGCAGAACGCCCAGAGCCAGAAGCAGAACGAAGAGTACAGACCCGATCAAGACAACTCTGCTTTCGTCTCCC
GAGAAAACGCCGTCGAAGAGGTTGACGGTTACGGCGGAGAGGACGTTGATTACATTATGCTGATTCGGTCCAACGAGAGG
CCGTTGAAGAGCCGAGACGCGATCCTCGAGTGCAAGAACAGAGATTTCCACAGCGTGTTGGTGAATTCGACCAAGAGGGA
AGAGGAGAGGCAGAGGATCGAGTCTCACCAGAGGAAAGACGGCTTGGTCGCCAAGAGTAGGTTGATGGGTGCTGAAGAGA
GAGGCATTGTAGGCTTCACCGGCGGCGGAGGTGATGATTCTGGTTATGATGCTAACCCTAAGTCTAAGCTTAGGAAGATT
GGGGAAGGTGTGCCGATCATTCTTGTCCCGAGTGCGTTTCAGACGCTGATTACTATATACAATGTGAAGGAGTTTCTTGA
GGATGGAGTTTATATACCGAATGATGTTAAGGCTAAGGAGATGAAAGGGGTGAAGCCTGATTGTATTACGGTTCAGAAGA
AGTTTAGTAGAGATAGGGAGAGGGTTGTGACTGCTTATGAGGTTAGGGATAAGCCTTCTGCTTTGAAGCCTGATGACTGG
GACCGTGTTGTTGCGGTTTTCGTGTTGGGCAAGGATTGGCAGTTCAAGGATTGGCCTTTCAAGGACCATGTTGAGATTTT
CAATAAGATAATTGGGTTCTTCTTGCGGTTTGAAGATGATAGTATTGAATCAGCCAAGACGGTGAAGCAGTGGAATGTGA
AGATTATCTCGATTAGTAAGAATAAGAGGCATCAAGACCGGGCTGCAGCATTAGAAGTCTGGGAAAAACTTGAGGAGTTT
GTTCGGTCTCGGTCACATTCTTAG