Details for Kale Locus Bo5g094600

Position : C5 ( 5`- 30757357 .. 30758241 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g094600

Protein [Map View]
MSFEDDFVEDDEMNMIDEDVASDSEAESLSDSDSENAITEKLAEPTKTAVYNRDGLLDKLQDISWPEDADWTHKLTVEIE
QGQAVDVNDDLAREMAFYTQALEGTRQAFEKLQEMGLPFLRPADYYAEMVKSDTHMEKVKSKLLYEKKQMEESEERRKAR
DNKKMAKEVQSQKMKERAKQKKDEIESVKKWRKQRQQSGFSEKGAGELDLEFGNGKSFQRGGGKKRPGVSPADRSGGKGK
PTSRMNNKKREFRDSKFGHGGRKGLSKQNTAETTNDFKGGFRGGKAGGNKRQKR*

DNA
ATGTCGTTTGAAGATGATTTTGTGGAAGACGATGAGATGAACATGATTGATGAAGACGTAGCATCTGACTCCGAAGCAGA
GTCTTTGTCAGATTCCGATTCAGAAAACGCGATCACTGAGAAGCTAGCTGAGCCGACAAAGACTGCTGTCTACAACAGAG
ATGGGCTTCTTGATAAGCTTCAAGACATAAGCTGGCCAGAAGATGCTGATTGGACTCATAAGCTCACCGTCGAGATTGAG
CAAGGACAAGCCGTTGATGTAAACGACGACCTCGCTAGAGAGATGGCCTTCTACACTCAAGCACTCGAAGGGACGAGGCA
GGCTTTCGAGAAGCTCCAGGAGATGGGACTGCCTTTCCTAAGGCCGGCGGATTACTACGCGGAGATGGTGAAATCAGATA
CGCACATGGAGAAGGTGAAGTCTAAGCTTCTGTACGAGAAGAAACAGATGGAGGAGTCTGAGGAGAGGAGGAAAGCGAGG
GATAACAAGAAGATGGCTAAGGAAGTACAGTCTCAGAAGATGAAGGAGCGCGCTAAGCAGAAGAAGGATGAGATTGAGTC
TGTCAAGAAGTGGAGGAAACAGAGGCAGCAGAGCGGGTTTAGTGAGAAAGGAGCAGGAGAGCTTGATCTTGAGTTTGGAA
ATGGGAAGAGTTTCCAGAGAGGAGGTGGTAAGAAGAGGCCGGGTGTGTCTCCTGCTGATCGATCAGGAGGTAAAGGGAAG
CCTACTTCGAGGATGAACAATAAGAAGAGGGAGTTTAGGGACTCCAAGTTTGGTCATGGTGGAAGGAAAGGGTTGAGCAA
GCAGAACACTGCAGAGACGACGAATGATTTCAAAGGAGGGTTTCGTGGAGGCAAAGCTGGTGGAAACAAGAGACAGAAGA
GATAA