Details for Kale Locus Bo5g093470

Position : C5 ( 5`- 30568737 .. 30570796 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093470

Protein [Map View]
MDPSYRFIKEEFPTGFIVSPSPPSSSTYSYLYSTSMAPNDPTTSSSPQPIEGLHESGPPPFLTKTYDLVEDSRTNHVVSW
SQAKNSFIVWDPQAFSTSLLPRFFKHNNFSSFARQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKTIRRRKTSNNNQIQP
PQSSSQEHSLDNCCIEVGRYDLDGEMDSLKQDKQVLVMELVKLRHQQESTKVYLKLIEEKLKKTESKQQQMMSFLARAMQ
NPDFLQQLMEQKEKRKEMEEAISKKRQRPIDQGTRNVVTVEDYDDDDSGARGGYGRYGNDAGSTSAYMKQEMYGDLSGFE
MPELDSLAMHIQGLGDQFTRKEVLDVEKRDEEGEQEGYQKVNNEIYGEGFWEDMLNEGQNFDFEGDEENVDVLIEQLGYL
GSSSN*

DNA
ATGGATCCTTCATATAGATTCATAAAAGAGGAGTTTCCTACTGGATTCATTGTTTCTCCATCACCACCATCTTCTTCAAC
TTATTCTTACCTCTATTCAACCTCCATGGCCCCAAATGATCCAACAACATCAAGCTCTCCACAGCCAATAGAAGGTCTCC
ACGAATCAGGCCCACCTCCATTTCTGACAAAGACATATGACTTGGTCGAAGATTCAAGAACCAATCATGTTGTGTCTTGG
AGCCAAGCCAAAAACAGCTTCATTGTCTGGGATCCACAAGCTTTTTCCACCAGTCTCCTCCCCAGATTCTTCAAGCACAA
TAACTTCTCTAGCTTTGCTCGCCAGCTCAACACATATGGTTTCAGAAAAGTGAATCCGGATCGGTGGGAGTTTGCAAATG
AAGGGTTTCTTAGAGGGCAAAAGCATCTCCTCAAGACAATAAGGAGAAGAAAGACAAGTAACAATAATCAAATACAACCA
CCTCAATCATCCTCACAAGAACATTCTCTAGACAACTGTTGCATAGAAGTTGGTAGGTATGATCTAGATGGAGAGATGGA
CAGCCTAAAACAAGACAAACAAGTGCTGGTGATGGAGCTAGTGAAACTGAGACATCAACAAGAAAGCACCAAAGTGTATC
TCAAATTGATTGAAGAGAAACTCAAGAAAACTGAATCAAAACAACAGCAAATGATGAGCTTCCTCGCCCGCGCAATGCAG
AATCCTGATTTCCTTCAACAACTCATGGAGCAGAAAGAGAAAAGAAAGGAGATGGAAGAAGCAATCAGCAAGAAGAGACA
AAGACCGATCGATCAAGGGACAAGAAATGTGGTTACTGTGGAAGATTATGATGATGATGATAGTGGTGCTAGAGGTGGTT
ATGGAAGGTATGGAAATGATGCTGGATCCACCTCAGCGTACATGAAACAAGAAATGTATGGAGACTTGTCTGGATTCGAG
ATGCCCGAGTTGGACAGTCTTGCTATGCATATTCAAGGACTTGGCGATCAGTTCACTAGAAAAGAAGTCTTGGATGTTGA
GAAAAGAGATGAAGAAGGAGAACAAGAAGGGTACCAAAAGGTGAACAATGAGATTTATGGTGAGGGTTTTTGGGAAGATA
TGTTAAATGAAGGTCAAAATTTTGATTTTGAAGGAGATGAAGAAAATGTTGATGTGCTCATTGAACAACTTGGTTATTTG
GGTTCTAGTTCAAACTAA