Details for Kale Locus Bo5g093450

Position : C5 ( 5`- 30537002 .. 30538294 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093450

Protein [Map View]
MERRQARSSKIHVFVLVGLILFSSTERISSLSVTVSDDECVQEYVLYEGDNVSGNFVVVDHDIFWGSDHPGLDFTVTSPA
GNIVHTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVSE
QKYLKARDTRHRHTNESTRKRVIFYTVGEYIFLAAARGLQVLYIRKLFSKSVAYNRV*

DNA
ATGGAGAGAAGACAAGCGAGGAGCTCGAAGATCCATGTCTTTGTACTCGTCGGTCTGATACTGTTTAGCTCGACCGAGCG
AATCTCATCGCTCTCAGTTACTGTTAGCGACGATGAATGCGTACAAGAGTATGTCCTTTACGAAGGAGATAACGTCTCCG
GAAACTTCGTTGTCGTCGACCATGATATCTTCTGGGGATCTGATCATCCCGGTTTGGATTTCACGGTGACGTCACCTGCT
GGGAACATAGTACATACGTTGAAGGGAACATCAGGAGATAAGTTTGAGTTCAAGGCACCAAGAAGTGGAATGTACAAGTT
TTGTTTCCATAACCCTTACTCTACTCCTGAAACTGTCTCCTTCTACATTCACGTTGGTCATATCCCCAACGAGCATGACT
TAGCTAAAGACGAACATTTGGACCCGGTGAATGTTAAAATAGCTGAGCTGAGAGAGGCTTTGGAGTCTGTTGTTTCTGAG
CAAAAGTATTTGAAAGCACGTGATACCCGTCACCGTCATACCAATGAGAGCACGAGAAAGCGAGTGATATTCTACACAGT
AGGAGAGTACATATTCCTAGCAGCAGCAAGGGGTCTTCAGGTTCTCTACATCCGCAAGCTCTTCAGCAAGTCGGTTGCAT
ACAACAGGGTTTGA