Details for Kale Locus Bo5g093400

Position : C5 ( 5`- 30471667 .. 30473750 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093400

Protein [Map View]
MASMSAVLSKSPFLSQPLSKSPSSDLPFSAATVSFPSKSHRRGGVIRAGLISPDGGKLVELVVSEPRRREKKHEAAELPR
VELTSIDVQWMHVLSEGWASPLGGFMRESEFLQTLHFNSLRLDDGSVVNMSVPIVLAIDDEQKASIGESKRVALVGSDGN
PVAILSDIEIYKHPKEERIARTWGTTAPGLPYVEEAITNAGNWLIGGDLEVLEPVKYNDGLDRFRLSPAELRKELEKRGA
DAVFAFQLRNPVHNGHALLMTDTRRRLLEMGYKNPILLLHPLGGYTKADDVPLSWRMKQHEKVLEDGVLDPETTVVSIFP
SPMHYAGPTEVQWHAKARINAGANFYIVGRDPAGMGHPVEKRDLYDADHGKKVLSMAPGLERLNILPFRVAAYDKTQGKM
AFFDPSRPQDFLFISGTKMRTLAKNKENPPDGFMCPGGWQVLVDYYDSLTQAGKLPVPA*

DNA
ATGGCTTCCATGTCTGCCGTCCTCAGCAAATCCCCTTTCCTCTCTCAGCCTCTCTCCAAATCTCCATCCTCCGATCTCCC
CTTCTCCGCTGCAACCGTTTCTTTCCCCTCGAAATCGCACCGTCGCGGCGGAGTAATCCGCGCCGGACTCATCTCTCCCG
ACGGCGGGAAGCTCGTGGAGCTCGTGGTGTCCGAGCCACGACGGCGGGAGAAGAAGCACGAGGCGGCGGAGCTGCCCCGC
GTGGAGCTCACGTCGATCGACGTGCAGTGGATGCACGTGCTGAGCGAAGGCTGGGCAAGTCCGCTCGGAGGCTTCATGAG
AGAATCCGAGTTCCTCCAAACTCTTCATTTCAACTCGCTTCGTCTTGACGACGGATCCGTCGTCAACATGTCTGTGCCTA
TCGTCCTCGCTATTGACGACGAGCAGAAGGCTAGTATCGGCGAGTCCAAACGCGTCGCGCTTGTTGGTTCCGATGGTAAC
CCCGTCGCTATCCTCAGCGACATTGAGATTTACAAACATCCCAAGGAAGAGAGAATAGCAAGAACTTGGGGTACGACGGC
TCCAGGCTTGCCTTACGTAGAAGAAGCCATTACTAACGCTGGAAACTGGCTGATTGGGGGTGACCTTGAGGTTCTTGAGC
CAGTCAAGTACAATGATGGGCTTGACCGTTTTAGGCTTTCCCCTGCTGAGCTTCGCAAGGAGCTGGAGAAGCGTGGCGCG
GATGCTGTCTTTGCTTTCCAGCTTAGGAACCCAGTTCACAACGGTCATGCACTTCTTATGACCGATACTCGGAGGAGACT
TCTTGAGATGGGATACAAAAACCCTATTCTTTTGCTTCATCCGTTAGGAGGGTACACAAAGGCTGATGATGTTCCTCTAA
GTTGGAGGATGAAGCAGCACGAGAAGGTGCTAGAGGACGGTGTTCTTGATCCAGAGACTACAGTAGTTTCGATATTCCCG
TCTCCTATGCATTATGCTGGTCCAACCGAAGTGCAGTGGCACGCAAAGGCGAGAATCAATGCCGGTGCAAACTTTTACAT
TGTGGGTCGTGATCCAGCCGGGATGGGTCACCCAGTTGAAAAACGTGATCTCTACGATGCTGATCATGGAAAGAAAGTAC
TAAGCATGGCCCCTGGACTTGAAAGACTCAATATCCTTCCTTTCAGGGTTGCTGCATATGACAAGACACAAGGCAAAATG
GCTTTCTTTGATCCCTCGAGGCCTCAAGATTTCTTGTTCATCTCCGGCACTAAGATGCGCACATTGGCCAAGAACAAAGA
AAACCCTCCAGATGGATTCATGTGCCCAGGTGGATGGCAAGTTCTTGTTGATTACTATGACAGCTTGACTCAAGCAGGTA
AACTACCGGTTCCGGCCTAA