Details for Kale Locus Bo5g093290

Position : C5 ( 5`- 30342323 .. 30343607 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093290

Protein [Map View]
MPFLMKIQPIDIDSPAVRETAARPVLKSRLKRLFDRPFTNVLRNATSEKPLHGGEVQCGGGAAVTEFEPSSVCLEKMVQN
FIEETNEKQAKCGRNRCNCFNGNNNDSSSDDDFDLFGGSAESFIGNASDHLKSLVTCVSVAETDLLADAAKIVDKNRSVK
RKEDLRKLLNEGLLSLHYDSSLCKSKWEKSPSFPTGEYEYIDVIVGEERLLIDVDFRSEFDIARQTRGFKALLQSLPFIF
VGKSDRLTQIVSLISEAAKQSLKKRGMHLPPWRKAEYMRSKWMSSYTRASVVASRNAEEPPATVAAAEPELDCAELELVF
EDKSLSPGVINSSSSPFPSVNGGDDDVAVEREVKVTGLASLFKERS*

DNA
ATGCCGTTTTTGATGAAGATCCAGCCGATTGATATCGATTCACCCGCCGTGAGAGAGACGGCAGCTCGACCGGTGCTCAA
ATCTCGCCTCAAGCGTTTGTTTGACCGGCCGTTCACAAACGTGCTGAGAAACGCAACCTCCGAGAAACCATTACACGGTG
GTGAAGTTCAATGCGGAGGAGGAGCGGCGGTGACGGAGTTCGAGCCGAGCTCCGTTTGCTTAGAGAAGATGGTTCAGAAC
TTCATAGAGGAAACGAACGAGAAGCAAGCCAAATGTGGACGCAACCGATGCAACTGCTTCAACGGAAACAACAACGATAG
CTCCTCCGACGATGATTTTGATCTCTTCGGTGGTTCAGCTGAGTCTTTCATCGGCAACGCCTCTGATCATCTCAAGAGTT
TGGTCACATGCGTGAGCGTCGCCGAGACGGACCTCTTAGCCGACGCGGCGAAGATCGTTGATAAGAACAGATCAGTCAAA
CGAAAAGAGGATCTGAGGAAGCTCCTCAACGAAGGACTCTTATCTCTTCACTACGATTCTTCACTCTGTAAATCCAAATG
GGAAAAATCTCCATCGTTCCCAACTGGTGAATACGAGTACATAGATGTGATTGTTGGAGAAGAACGGTTGTTAATCGACG
TTGATTTCCGATCAGAGTTCGATATCGCGAGGCAGACGAGGGGTTTCAAGGCGTTGCTTCAATCTCTACCCTTCATCTTC
GTCGGCAAATCCGATCGATTAACTCAGATCGTCTCGTTGATCTCCGAGGCGGCGAAACAAAGCTTGAAGAAGAGAGGGAT
GCATTTGCCTCCGTGGAGGAAAGCAGAGTACATGCGATCTAAGTGGATGTCCTCTTACACCAGAGCTTCCGTCGTTGCTT
CTCGAAACGCTGAAGAGCCGCCTGCTACGGTGGCCGCGGCTGAGCCGGAGCTTGATTGTGCAGAGCTTGAGCTGGTTTTC
GAGGATAAATCTTTATCTCCGGGAGTGATTAATTCTTCCTCCTCTCCTTTTCCGTCTGTTAACGGCGGTGATGATGATGT
GGCCGTGGAGAGAGAAGTGAAGGTCACCGGCTTAGCTTCTTTGTTCAAGGAAAGGTCTTAA