Details for Kale Locus Bo5g093250

Position : C5 ( 5`- 30289454 .. 30292492 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093250

Protein [Map View]
MDESDARNIRNICILAHVDHGKTTLADHLIASSGDGELLKPRLAGKVRYMDYLDEEQRRAITMKSSSISLRYKDYSLNLI
DSPGHMDFCSEVSTAARLSDGALVLVDAVEGVHIQTHAVLRQAWIEKLTPCLVLNKIDRLICELRLSPMEAYTRLIRIVH
EVNGIVSAYKSEKYLSDVDSILASPSGEITDESLELLEDDEEVTFQPQKGNVVFVCALDGWGFGVSEFANFYASKLGAKA
DTLQKSLWGPRYYIPKTKMIVGKKSLSAGSKTKPMFVQFVLDPLWQVYEAALDPGGDRAVLEKVIKSFNLIIPQRELQNK
DPKNLLQSVMSRWLPLSDAVLSMAVKHLPDPISAQAYRIPRLVPERKVIGGNEVDSSVLAEAELVRRSIEACDSSRDSPC
VVFVSKMFAIPMKMIPQGGDHRERMNGLNDDDSKSESDECFLAFARIFSGVLRAGQRVFVISALYDPLKGESSQKYIQEA
ELHSIYLMMGQGLKPVNEVKAGNVVAIRGLGPYISKSATLSSTRNCWPLASMEFQVSPTLRVAIEPSDPSDMSALMKGLR
LLNRADPFVEITVSARGEHVLAAAGEVHLERCIKDLTDRFARVNIEVSSPLVSYRETIEGDGSNLLESLRSLSLNASDYV
EKRTPNGRCVIRVHVMKLPHSLTKLLDESTDLLGDIIGGKGSHSIKILESQSPSLEENVDPVEALKNQLVEAGVSSSSET
ENDREKCKAEWAKLLKRIWALGPREKGPNILFAPDGKRICEDGSILVRGSPHVSQRLGFTEDSTETPPDSALYSEALTLE
SSIVSGFQLATASGPLCDEPMWGLAFTIESHLAEDSETEKQPENFGIFTGQVMTAVKDACRAAVLQTNPRIVEAMYFCEL
NTAPEYLGPMYAVLSRRRARVLKEEMQEGSSLFTVHAYVPVSESFGFAEELRKGTSGGASALMVLSHWEMLEEDPFFVPK
TEEEIEEFGDGASVLPNTARKLINAVRRRKGLHVEEKVVQHATKQRTLARKV*

DNA
ATGGATGAGTCTGATGCTAGGAACATTAGGAACATTTGCATCTTAGCACACGTAGACCACGGTAAAACAACTCTCGCTGA
CCACCTCATTGCTTCCTCCGGTGACGGTGAGCTGCTTAAACCGAGGCTTGCTGGTAAGGTTAGGTACATGGACTATCTCG
ATGAAGAGCAGAGGCGCGCTATCACCATGAAAAGCTCCTCGATTTCTCTTCGGTACAAGGACTATTCTCTCAACTTGATT
GACTCCCCTGGACACATGGACTTCTGTAGTGAAGTCTCTACAGCTGCTCGACTTAGTGATGGTGCTTTGGTTCTGGTTGA
TGCTGTTGAAGGTGTTCATATTCAGACCCATGCTGTGTTGCGACAAGCTTGGATTGAGAAGCTGACTCCTTGCTTGGTGC
TTAACAAGATTGATAGGCTGATTTGTGAGTTGAGGTTGAGTCCCATGGAAGCATATACTCGTTTGATTAGAATTGTTCAT
GAGGTTAATGGGATTGTGAGTGCGTATAAGTCTGAGAAGTATTTGTCTGATGTTGACTCTATACTTGCGAGTCCTTCAGG
TGAGATTACTGATGAGAGTCTTGAGTTGTTGGAGGATGATGAAGAGGTTACGTTTCAGCCTCAGAAGGGTAATGTGGTCT
TTGTGTGTGCTTTGGATGGATGGGGCTTTGGGGTCTCTGAGTTTGCTAATTTCTATGCTTCCAAGCTTGGAGCTAAAGCG
GATACGTTGCAGAAATCATTATGGGGTCCTCGTTATTATATTCCTAAGACAAAGATGATTGTAGGGAAGAAGTCTTTAAG
TGCGGGAAGCAAGACAAAACCAATGTTTGTGCAGTTCGTGCTTGATCCTTTGTGGCAGGTTTACGAGGCTGCACTAGATC
CCGGCGGTGATAGAGCTGTTCTCGAGAAAGTTATCAAATCTTTTAACTTGATTATTCCACAACGCGAGCTTCAGAACAAG
GATCCTAAAAACTTGCTTCAATCAGTGATGAGCCGTTGGCTTCCTTTGTCTGATGCAGTCTTGTCTATGGCTGTGAAACA
TCTGCCAGACCCCATTTCAGCACAGGCATATAGAATCCCACGCTTGGTTCCAGAAAGAAAAGTTATAGGTGGTAACGAGG
TTGATTCAAGTGTCCTTGCAGAAGCAGAGCTTGTTAGAAGATCAATTGAGGCTTGTGACTCTAGCCGTGACTCCCCCTGT
GTTGTGTTTGTATCTAAAATGTTCGCTATTCCCATGAAAATGATACCTCAGGGAGGAGACCACAGGGAGAGGATGAACGG
TTTAAATGATGACGACAGTAAAAGCGAGTCGGATGAGTGTTTCCTTGCATTTGCCAGGATCTTTAGCGGTGTTCTTCGCG
CCGGACAAAGGGTCTTTGTGATTTCCGCTCTATATGATCCTCTCAAAGGCGAATCGTCTCAGAAGTACATTCAAGAAGCA
GAACTCCACTCAATCTATCTTATGATGGGACAAGGTTTAAAACCAGTAAACGAGGTGAAAGCTGGGAATGTAGTGGCCAT
AAGAGGGCTTGGACCATATATATCAAAAAGCGCCACACTTTCATCTACTAGAAACTGCTGGCCCTTAGCCAGCATGGAGT
TTCAGGTCTCTCCCACTCTTAGAGTGGCGATTGAGCCATCGGATCCTTCAGATATGAGTGCTCTGATGAAAGGTCTAAGA
CTTTTGAACCGAGCAGATCCTTTTGTGGAGATCACGGTGTCTGCTCGAGGAGAACATGTGCTTGCTGCTGCTGGAGAAGT
TCATCTAGAAAGATGTATCAAGGATTTGACAGACAGATTTGCAAGAGTGAACATTGAAGTCTCTTCGCCTCTCGTTTCCT
ACAGGGAGACAATTGAAGGTGATGGCTCTAATCTTTTGGAAAGTTTGAGATCTCTGAGCTTGAATGCGTCGGATTACGTT
GAGAAGAGAACTCCAAACGGCAGATGCGTTATCAGAGTACACGTCATGAAACTACCACACTCCCTAACCAAGCTGCTTGA
TGAGAGCACTGACTTGCTTGGTGACATTATTGGAGGCAAAGGCAGTCATAGCATTAAGATACTAGAATCTCAAAGCCCTA
GCCTCGAAGAGAATGTGGATCCCGTTGAAGCATTAAAGAACCAGTTAGTTGAAGCTGGCGTTTCATCAAGCTCTGAAACC
GAGAATGATCGTGAGAAGTGCAAAGCTGAGTGGGCGAAGTTGCTCAAGAGGATATGGGCGCTTGGTCCAAGAGAGAAAGG
TCCAAACATACTATTTGCTCCAGATGGTAAAAGAATCTGCGAGGATGGATCCATTCTCGTGCGAGGCTCTCCTCATGTCT
CTCAGAGACTTGGCTTCACAGAAGATTCTACTGAGACACCACCTGACTCAGCATTGTACAGTGAAGCTCTTACTCTCGAA
AGCAGCATAGTCTCGGGGTTTCAGCTAGCTACAGCATCAGGACCTCTATGTGATGAACCAATGTGGGGATTAGCTTTCAC
CATTGAGTCTCATCTCGCAGAAGATTCAGAAACAGAGAAACAACCTGAAAACTTTGGAATATTCACAGGACAAGTCATGA
CAGCTGTCAAAGACGCATGTAGAGCCGCCGTGCTTCAGACAAATCCACGGATCGTGGAAGCTATGTACTTCTGCGAGCTA
AACACAGCACCGGAGTATCTTGGTCCCATGTACGCCGTTCTGAGCAGAAGACGAGCTAGAGTTCTCAAGGAAGAAATGCA
AGAAGGGTCGTCTCTGTTTACAGTCCATGCCTACGTGCCCGTTTCTGAAAGTTTCGGTTTTGCAGAAGAGCTGAGAAAAG
GAACGTCAGGTGGTGCGAGTGCGCTGATGGTTCTGAGCCATTGGGAAATGCTCGAGGAAGATCCCTTCTTTGTTCCCAAA
ACTGAAGAAGAGATTGAAGAGTTTGGTGATGGAGCAAGCGTGCTTCCCAACACGGCGAGGAAGCTCATCAACGCCGTGAG
ACGCAGGAAAGGGTTACACGTTGAGGAGAAAGTGGTCCAACACGCCACTAAACAGAGAACCTTGGCTCGGAAAGTTTGA