Details for Kale Locus Bo5g093240

Position : C5 ( 5`- 30286701 .. 30288690 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093240

Protein [Map View]
MQKREFAKSGGQSGGSSAPPAKRGRPFGSTSANSAAAAAAAAAAEAMSPSALLGPSLLVHNSFVEQNNKRIVLALQSGLK
SEVTWALNTLTLLSFKERDDIRRDFTPLAKIPGLLDSLLLIIDDWRDIALPKDLTRGTRVRSLGVNSSVTGFGSEYDALA
SLQPPGSGAGSAAGEVLGKKSKHLSSQWWNEEDGLFNLDDEGRAEKQLCAVAASNVIRNFSFMPDNEVVMAQHRHCLETV
YQCINDHMTEDEELVTNSLETIVNLAHLMDLRIFSSSKQSYIKINEKQAVQAVLGILNSSVKAWNCAAAELLGRLIINPD
NEPFISPLIPQIHKRLVDLLSIPAVDAQAAAVGALYNLVEVNMDCRLKLASERWAIDRLLKVIKTPHPVPEVCRKAAMIL
ENLVSEPQNRGFLLAYENAFAELLFQDGKYSDSFARILYELTARSNSRVASARGIWGM*

DNA
ATGCAGAAACGAGAGTTTGCGAAATCCGGCGGTCAGTCGGGTGGATCTTCGGCTCCGCCAGCGAAGAGAGGCCGACCCTT
CGGTAGTACGAGTGCAAACTCTGCAGCTGCAGCAGCTGCGGCGGCGGCGGCGGAAGCGATGTCTCCGTCAGCTCTACTCG
GTCCTTCTCTTCTTGTTCACAATTCCTTCGTCGAGCAGAACAACAAGAGAATAGTGCTGGCGTTACAGAGTGGTCTGAAG
AGCGAGGTGACATGGGCGTTGAACACACTTACACTGCTCTCCTTCAAAGAAAGAGATGATATTCGTAGAGATTTCACTCC
TCTTGCTAAGATCCCTGGCTTGCTTGACTCCCTTCTCTTAATCATTGATGATTGGCGTGACATAGCTCTCCCTAAGGACT
TAACAAGAGGAACTAGGGTCAGGTCTTTAGGTGTGAATTCTTCTGTTACAGGATTCGGGAGCGAGTACGATGCTCTTGCC
TCTCTTCAACCACCTGGATCCGGAGCTGGCTCTGCAGCTGGTGAGGTGTTAGGGAAAAAGAGCAAACATCTGTCATCTCA
GTGGTGGAATGAAGAGGATGGTTTGTTTAATCTAGACGATGAAGGCAGAGCAGAGAAACAGCTTTGCGCCGTTGCTGCAT
CTAACGTCATTCGCAACTTCTCCTTCATGCCTGATAATGAGGTTGTAATGGCTCAGCATCGCCATTGCTTGGAAACTGTT
TACCAGTGCATTAACGATCATATGACCGAGGATGAAGAGCTGGTCACAAACTCGCTTGAGACCATTGTGAACCTAGCGCA
TTTGATGGATCTTCGTATTTTCAGCTCGTCTAAACAGTCATACATCAAGATTAATGAAAAGCAAGCAGTTCAAGCTGTCT
TAGGGATTCTCAATTCTTCTGTCAAAGCTTGGAACTGTGCTGCTGCTGAACTGCTGGGCCGTTTGATAATCAATCCAGAC
AATGAACCTTTCATTAGTCCCTTGATTCCGCAGATACACAAGAGACTAGTCGATCTCTTGAGCATACCAGCCGTTGATGC
CCAAGCTGCAGCTGTTGGGGCACTCTACAATCTTGTCGAAGTAAACATGGATTGTAGACTAAAGCTTGCTAGTGAGAGAT
GGGCGATTGATAGATTGTTGAAAGTGATAAAGACTCCGCATCCGGTTCCAGAAGTCTGCAGGAAAGCTGCAATGATTCTA
GAGAACCTTGTCTCCGAGCCACAGAACAGAGGGTTCTTACTGGCGTATGAGAATGCTTTTGCTGAGCTGCTCTTTCAAGA
TGGCAAGTATTCTGATTCGTTTGCGAGGATTTTGTATGAACTAACTGCTAGATCAAATAGCAGAGTCGCTTCGGCTAGGG
GAATCTGGGGAATGTAA