Details for Kale Locus Bo5g093210

Position : C5 ( 5`- 30255312 .. 30256589 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g093210

Protein [Map View]
MDSLPQPQNQSSPAKILLGKYELGRRLGSGSFAKVHLGRSIETHELVAIKIIDKKRTIESNMEPRIIREIDAMRRLRDHP
NILKIHEVMATKSKIYIVMELAVGGELFFKLLHRGRLPESAARRYFQQLASALQFSHLHGVAHRDVKPQNLLLDKEGNLK
VSDFGLSALPEHLRDGLLHTACGTPAYTAPEIISRRGYDGAKADAWSCGVILYVLLVGYVPFDDSNIASMYRKIQRREYR
FPSWISKQARSIIHQMLDPNPETRMSLEAVMNTTWFKKSLTGSELDCNVLEPEPEPVIEKSSSITAFDLISLSSGLDLSG
LFEVKRKRERRFTAKVSAVEVEEKAKAIGEKLGYVVKKTKKGGEAKVVGLGRGRMEIVVEAVELAVDIVVVEVKVVEGEE
EEDSQWSDLITELGDIVLSRHTDVM*

DNA
ATGGACTCTCTTCCTCAACCGCAGAACCAGTCATCTCCGGCGAAAATTCTCCTCGGAAAATACGAGCTAGGCCGCCGTCT
CGGCAGCGGAAGCTTCGCGAAAGTCCATTTAGGTCGTTCCATCGAAACCCACGAGCTTGTCGCCATCAAAATCATCGATA
AGAAGAGAACCATCGAGTCCAACATGGAGCCAAGGATCATCCGTGAGATAGACGCGATGCGTCGTCTCCGCGACCATCCC
AACATCCTCAAGATCCACGAGGTCATGGCGACCAAATCCAAAATCTACATCGTCATGGAACTCGCCGTCGGCGGCGAGCT
TTTCTTCAAACTCCTCCACCGCGGCCGTCTTCCCGAATCCGCCGCTCGTCGTTACTTCCAGCAGCTCGCCTCAGCGCTTC
AGTTCTCCCACCTCCACGGCGTCGCTCACCGCGACGTGAAGCCGCAGAATCTCCTCCTCGACAAGGAAGGGAACCTAAAG
GTCTCGGACTTCGGTTTATCCGCTTTGCCGGAGCATCTTCGAGACGGATTGCTCCACACGGCGTGCGGTACGCCGGCTTA
CACGGCTCCGGAGATTATATCGCGGCGAGGATACGACGGAGCGAAGGCTGATGCGTGGTCTTGTGGAGTGATACTGTACG
TTCTTCTCGTCGGATACGTTCCTTTCGACGATTCCAACATTGCTTCAATGTATCGGAAGATTCAACGGAGAGAGTATCGT
TTCCCGAGCTGGATCTCGAAGCAAGCGAGATCGATTATACATCAGATGCTTGATCCGAATCCTGAGACGAGGATGAGTCT
AGAGGCGGTTATGAATACAACCTGGTTCAAGAAATCGTTAACCGGTTCTGAATTGGATTGTAACGTCCTCGAACCGGAAC
CGGAACCGGTTATTGAGAAATCGAGTTCGATCACGGCCTTTGATCTTATCTCGCTTTCGTCGGGGCTAGATCTCTCCGGA
TTGTTTGAGGTTAAGAGAAAGAGAGAGAGGAGGTTCACGGCGAAAGTCTCCGCCGTGGAAGTGGAGGAGAAAGCGAAGGC
GATTGGGGAGAAGTTAGGTTATGTAGTGAAGAAGACGAAGAAAGGAGGTGAAGCGAAGGTAGTTGGATTAGGAAGAGGAA
GAATGGAGATAGTTGTGGAGGCGGTGGAGTTAGCGGTGGATATTGTGGTGGTTGAAGTGAAAGTTGTTGAAGGAGAAGAA
GAAGAAGACTCACAGTGGTCCGATTTGATAACAGAGCTTGGAGATATAGTTCTCTCACGGCACACTGACGTCATGTAA